load-page

Terminology English – German 1016 European construction of 10 EUROPEAN UNION Part 6

Home/Blog/Terminology English – German 1016 European construction of 10 EUROPEAN UNION Part 6
Terminology English - German 2836 social protection

Inter Active Terminology of Europe

Terms English – German 1016 European construction of 10 EUROPEAN UNION Part 6

Domain: 10 EUROPEAN UNION

Subdomain: 1016 European construction

  No.

  English US

 German DE

5000group visaSammelvisum
5001correction noteKorrekturvermerk
5002exceptional visaAusnahmesichtvermerk
5003seriesSerienbereich
5004correction to validityGültigkeitskorrektur
5005extension noteVerlängerungsvermerk
5006official code numberBehördenkennziffer
5007mechanical erasuremechanische Rasur
5008Central office for combating serious fraudOCRGDF
5009illegal brokerage of wasteillegale Maklergeschäfte
5010Balkan pipelineBalkanroute
5011surveillance operationoperationelle Kontrolle
5012unlawful supply of labourillegale Arbeitnehmerüberlassung
5013mass influx of refugeesMassenzustrom von Flüchtlingen
5014person entitled under Community lawgemeinschaftsrechtlich Begünstigter
5015connections between criminal offencesZusammenhänge von Straftaten
5016EU Action Plan on DrugsAktionsplan der Europäischen Union zur Drogenbekämpfung
5017institutionalised ministerial meeting between the European Union and the Rio Groupinstitutionalisierte Ministertagung der Europäischen Union und der Rio-Gruppe
5018Resolution on manifestly unfounded applications for asylumEntschliessung über offensichtlich unbegründete Asylanträge
5019administrator of MostarAdministrator von Mostar
5020triadTriade
5021dentSchattierung
5022FAWEUFAWEU
5023acquittalFreispruch
5024small-time courierKleinschleuser
5025Revolutionary Organisation 17 NovemberRevolutionäre Organisation 17. November
5026free-text storageFreitextspeicherung
5027multiple and serious offendersMehrfach- und Intensivtäter
5028Eminent Persons Working PartyGruppe hochrangiger Persönlichkeiten
5029NADBANKNordamerikanische Entwicklungsbank
5030confiscation of the proceeds crimeVerfall krimineller Gewinne
5031business meetingGeschäftstagung
5032Consultative Commission on Racism and XenophobiaBeratende Kommission “Rassismus und Fremdenfeindlichkeit”
5033EU common format emergency travel documenteinheitlicher Rückkehrausweis der EU
5034decertificationDezertifizierung
5035fictitious documentFingierung
5036CPEPlanwirtschaftsländer
5037Representative of the Land of … to the Federal GovernmentBevollmächtigter/Bevollmächtigte des Landes … beim Bund
5038sticker containing personal detailsPersonalisierungsaufkleber
5039Berlin Declaration on Increased Cooperation in Combating Drug Crime and Organised Crime in EuropeBerliner Erklärung über eine verstärkte Zusammenarbeit bei der Bekämpfung der Rauschgiftkriminalität und der Organisierten Kriminalität in Europa
5040illicit trafficking in motor vehiclesKraftfahrzeugverschiebung
5041index systemIndexsystem
5042confidentialityGeheimhaltung
5043headquarters StateSitzstaat
5044silence procedureVerfahren der stillschweigenden Zustimmung
5045call associated dataverbindungsrelevante Daten
5046Advisory Working Party on Joint Action regarding Bosnia and HerzegovinaBeratende Gruppe für die Gemeinsame Aktion Bosnien-Herzegowina
5047refusalablehnende Entscheidung
5048refusal of entryZurückweisung
5049JSAGK
5050to have deletedKlage auf Löschung
5051requirements of law-enforcement agencies to conduct lawful interception of telecommunications servicesAnforderungen der gesetzlich ermächtigten Behörden im Hinblick auf die rechtmässige Überwachung des Fernmeldeverkehrs
5052controlled drugerfasste Droge
5053International Coffee Agreement (1994)Internationales Kaffee-Übereinkommen (1994)
5054request for provisional arrestErsuchen um vorläufige Festnahme
5055extension of alertsverlängerte Ausschreibung
5056Commander of Länder Riot PoliceIBPdL
5057Joint Committee of the EC-Turkey Customs UnionGemischter Ausschuss der Zollunion EG-Türkei
5058situation reportLagebild
5059recording criteriaErfassungskriterien
5060facilitated aliengeschleuster Ausländer
5061route of facilitationSchleusungsroute
5062organised traffickinggewerbs- und bandenmässiges Einschleusen von Ausländern
5063trafficking outAusschleusungen
5064trafficking throughDurchschleusungen
5065expulsionaufenthaltsbeendende Massnahme
5066Barcelona ProcessBarcelona-Prozess
5067Euro-Mediterranean Economic AreaEuropa-Mittelmeer-Wirtschaftsraum
5068ECO messageECO-Meldung
5069opinion of the Political CommitteeStellungnahme des Politischen Komitees
5070Evaluation GroupFollow-up-Gruppe
5071Bank for Economic Cooperation and Development in the Middle East and North AfricaBank für die Entwicklung des Nahen Ostens und Nordafrikas
5072alarm flash false documentsAd-hoc-Warnmeldung “Gefälschte Dokumente”
5073Atlas of Police Systems in the European UnionAtlas der Polizeibehörden
5074anti-fraud activityBekämpfung von Betrügereien
5075Euro-Mediterranean Association AgreementEuropa-Mittelmeer-Abkommen zur Gründung einer Assoziation
5076experts on the Australia group/Chemical Weapons Convention listsSachverständige “Listen der Australischen Gruppe/Übereinkommen über chemische Waffen”
5077ETIWirtschaftstrends und Wirtschaftsfragen
5078CTIKomitee für Handel und Investitionen
5079EPGGruppe hochrangiger Persönlichkeiten
5080Europol intelligence officerEuropol-Beamter der Abteilung “Intelligence”
5081accessZugriff
5082callAnruf
5083LEAgesetzlich ermächtigte Behörde
5084Law Enforcement Monitoring FacilityÜberwachungseinrichtung der gesetzlich ermächtigten Behörde
5085target serviceüberwachter Telekommunikationsdienst
5086UNCCDÜbereinkommen der Vereinten Nationen zur Bekämpfung der Wüstenbildung in den von Dürre und/oder Wüstenbildung schwer betroffenen Ländern, insbesondere in Afrika
5087NIPNationales Indikativprogramm
5088European Youth Campaign against Racism, Xenophobia, Antisemitism and IntoleranceEuropäische Jugendkampagne gegen Rassismus, Fremdenfeindlichkeit, Antisemitismus und Intoleranz: “Alle anders – alle gleich”
5089adjacent national control officesnebeneinanderliegende nationale Grenzabfertigungsstellen
5090the social bodiesgesellschaftliche Akteure
5091MC&AKernmaterialbuchführung und -kontrolle
5092new mediterranean instrumentneues Mittelmeerinstrument
5093Euro-Mediterranean Ministerial ConferenceEuropa-Mittelmeer-Konferenz auf Ministerebene
5094intelligenceInformationsgewinnung
5095returning authorityÜbergebender
5096admitting authorityÜbernehmender
5097returning StateÜbergabestaat
5098structured dialoguestrukturierter Dialog
5099LipoveniLipovener
5100to obtain, collate and analyse information and intelligenceInformationen und Erkenntnisse sammeln, zusammenstellen und analysieren
5101computerised system of collected informationautomatisierte Informationssammlungen
5102OSCE Senior Councilder Hohe Rat der KSZE
5103OSCE Permanent CouncilStR
5104Europol shall liaise with a single national unitEuropol ist mit einer einzigen nationalen Stelle verbunden
5105third bodyDrittstelle
5106audit logProtokollierung
5107confidentiality agreementGeheimschutzabkommen
5108Subcommittee on Information, Communications and the MediaUnterkommission “Information, Kommunikation und Medien”
5109Subcommittee on Education and TrainingUnterkommission “Erziehung und Ausbildung”
5110Subcommittee on Police and JusticeUnterkommission “Polizei und Justiz”
5111urban violenceGewaltdelikte in den Städten
5112sensitive activitysicherheitsempfindliche Tätigkeit
5113Treaty concerning the accession of the Kingdom of Norway, the Republic of Austria, the Republic of Finland and the Kingdom of Sweden to the European UnionVertrag zwischen dem Königreich Belgien, dem Königreich Dänemark, der Bundesrepublik Deutschland, der Griechischen Republik, dem Königreich Spanien, der Französischen Republik, Irland, der Italienischen Republik, dem Großherzogtum Luxemburg, dem Königreich der Niederlande, der Portugiesischen Republik, dem Vereinigten Königreich Großbritannien und Nordirland (Mitgliedstaaten der Europäischen Union) und dem Königreich Norwegen, der Republik Österreich, der Republik Finnland, dem Königreich Schweden über den Beitritt des Königreichs Norwegen, der Republik Österreich, der Republik Finnland und des Königreichs Schweden zur Europäischen Union
5114Act concerning the conditions of accession of the Kingdom of Norway, the Republic of Austria, the Republic of Finland and the Kingdom of Sweden and the adjustments to the Treaties on which the European Union is foundedAkte über die Bedingungen des Beitritts des Königreichs Norwegen, der Republik Österreich, der Republik Finnland und des Königreichs Schweden und die Anpassungen der die Europäische Union begründenden Verträge
5115ACCEEAMOEL
51161994 Oslo Protocol on Further Reduction of Sulphur EmissionsProtokoll zu dem Übereinkommen von 1979 über weiträumige grenzüberschreitende Luftverunreinigung betreffend die weitere Verringerung von Schwefelemissionen
5117justification for crimes against humanityVerherrlichung von Verbrechen gegen die Menschlichkeit
5118crime against peaceVerbrechen gegen den Frieden
5119crime against humanityVerbrechen gegen die Menschheit
5120PCA UkraineAbkommen über Partnerschaft und Zusammenarbeit zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten und der Ukraine
5121EU Administration of MostarEU-Administration der Stadt Mostar
5122Agreement on partnership and cooperation establishing a partnership between the European Communities and their Member States, of the one part, and the Russian Federation, of the other partAbkommen über Partnerschaft und Zusammenarbeit zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten und der Russischen Föderation
5123civil peaceinnerer Friede
5124UMunbegleitete Minderjährige
5125primary penaltyHauptstrafe
5126supplementary penaltyZusatzstrafe
5127Green LineGrüne Linie
5128pre-accession strategyHeranführungsstrategie
5129immobiliserKraftfahrzeug-Wegfahrsperre
5130FSCFSK
5131conflict prevention and crisis management missionAufgaben der Konfliktverhütung und der Krisenbewältigung
5132technical and forensic policeKriminaltechnik und -wissenschaft
5133OSCE TroikaOSZE-Troika
5134springboard countrySprungbrettland
5135proactive documentation support serviceDokumentationsmaterial im Bereich der Vorermittlungen
5136Draft Resolution on minimum guarantees for asylum proceduresEntschliessung des Rates über Mindestgarantien für Asylverfahren
5137PCA with MoldovaAbkommen über Partnerschaft und Zusammenarbeit zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten einerseits und der Republik Moldau andererseits
5138window threadunterbrochen sichtbarer Faden
5139linen proverFadenzähler
5140recoveryWiederherstellung
5141GyrogramGyrogramm
5142proportional guillocheabgepasste Guillochen
5143sliceAustrittsöffnung
5144illegal shipmentillegale Abfallverbringung
5145specific flows of wastespezifische Abfallverbringungswege
5146substance harmful to the environmentumweltschädlicher Stoff
5147incitement to racism and xenophobiaAufstachelung zu Rassismus und Fremdenfeindlichkeit
5148image archiving system for document images in actual operationBildspeichersystem für Urkundenbilder im tatsächlichen Wirkbetrieb
5149data formats and protocolsDatenformate und -protokolle
5150access securityZugriffssicherheit
5151ancillary proceedingNebenverfahren
5152confiscation of criminal proceedsAbschöpfung der Erträge aus Straftaten
5153EC-Lebanon Policy Grouppolitische Gruppe EG-Libanon
5154obligations enforceable by sanctionsanktionsbewehrte Verpflichtungen
5155false documentary evidenceFalschbeurkundung
5156victims of illegal immigration networksSchleuseropfer
5157airtight evidencelückenlose Beweisführung
5158use of undercover detectivesVerwendung verdeckter Ermittler
5159petty crimesBagatellkriminalität
5160border police tacticsgrenzpolizeiliche Einsatztaktik
5161notification in the joint listAusschreibung in der gemeinsamen Liste
5162letter bombBriefbombe
5163parcel bombSprengstoffpaket
5164suspected offencesSchuldverdacht
5165trafficking methodsSchleusungsmethoden
5166consular registration cardvon Konsulaten ausgestellte Meldebescheinigung
5167travel document found to be irregularinkriminiertes Reisedokument
5168procurement of documents for the journey homeBeschaffung von Heimreisedokumenten
5169coordination of expulsion measuresSchubkoordinierung
5170Information ExchangeInfo-Börse
5171indirect false authenticationmittelbare Falschbeurkundung
5172falsification of personal dataVerfälschung der Personendaten
5173counterfeiting of document dataVerfälschung der Dokumentendaten
5174place of issueAusstellungsort
5175page containing visa(s)Visaseite
5176form found blankals Blanko gefundenes Formular
5177deporteeSchübling
5178overall national situationnationales Gesamtlagebild
5179specific request for informationzielgerichtetes Informationsgesuch
5180ESDIESVI
5181institutional capacityLeistungsfähigkeit der Institutionen
5182photographic techniquefotografisches Verfahren
5183expulsion scheduleAbschiebeflugplan
5184problem StateProblemstaat
5185passport replacement papersPassersatzpapiere
5186related criminal offenceZusammenhangstat
5187travel facilities for school pupils from third countries resident in a Member StateReiseerleichterungen für Schüler von Drittstaaten mit Wohnsitz in einem Mitgliedstaat
5188identity of purposeNämlichkeit des Gegenstands
5189SITCENLagezentrum der WEU
5190nonaggression pledgeNichtangriffsverpflichtung
5191wrongful retention of funds from the general budget of the European Communitiesunrechtmässige Zurückbehaltung
5192rendez-vous clauseÜberprüfungsklausel
5193repressive technologiesRepressivtechnik
5194covert investigatorV.E.
5195Petersberg missionsPetersberg-Aufgaben
5196treaty on good neighbourly relationsVertrag über gutnachbarliche Beziehungen
5197banditryBanditentum
5198forgery offenceFälschungsdelikt
5199false documentFalsifikat
5200overwriting charactersÜberschreiben von Schriftzeichen
5201erasing with a knifeRadieren mit einem Messer
5202falsely issued documentfälschlich ausgestellte Urkunde
5203blank passportBlankopassformular
5204drafting errorredaktionelles Versehen
5205implausibilityUnplausibilität
5206fictitious documentsFingierung
5207club membership cardVereinsausweis
5208oblique lightSchräglicht
5209transmitted lightDurchlicht
5210UNIIMOGMilitärische Beobachtergruppe der Vereinten Nationen für Irak und Iran
5211UNIKOMBeobachtermission der Vereinten Nationen für Irak und Kuwait
5212diameter in denierDurchmesser (in Denier)
5213the presumed false documentmutmassliches Falsifikat
5214latent imprintslatente Aufdrucke
5215hologram which “moves” when viewedoptokinematisches Hologramm
5216laminated covering with latent technical safety featuresFolienüberzug mit latenten Sicherungen
5217break in the stamp imprintUnterbruch im Stempelabdruck
5218stroke screenStrichraster
5219point screenPunktraster
5220overlapping cut edgesüberstehende Schnittränder
5221non-standard colouringfarbliche Abweichung
5222check listCheckliste
5223UNPREDEPPräventiveinsatztruppe der Vereinten Nationen
5224relief of the watermarkWasserzeichenrelief
5225security thread bearing small printSicherheitsfaden mit Kleindruck
5226joint itemgemischte Zuständigkeit
5227motifs in varying shades of greygrau abgestufte Motive
5228reversed-out letteringNegativdruck
5229three-colour fluorescent threaddreifarbiger fluoreszierender Faden
5230inked embossed stampFarbprägestempel
5231OSCE AGOSZE-Unterstützungsgruppe
5232Convention drawn up on the basis of Article K.3 of the Treaty on European Union, on simplified extradition procedure between the Member States of the European UnionÜbereinkommen aufgrund von Artikel K.3 des Vertrags über die Europäische Union über das vereinfachte Auslieferungsverfahren zwischen den Mitgliedstaaten der Europäischen Union
5233microscopic glass beadsMikroglaskugeln
5234polymer binderPolymerbindemasse
5235anamorphic charactersanamorphotische Buchstaben
5236Document of the States Parties to the Treaty on Conventional Armed Forces in EuropeDokument der Vertragsstaaten des Vertrags über konventionelle Streitkräfte in Europa
5237continuous tone printingHalbtondruck
5238principle of non-legalisationGrundsatz der Nichtlegalisierung
5239principle of judicial freedom in weighing evidenceGrundsatz der freien richterlichen Beweiswürdigung
5240management teamManagement-Team
5241study on Eurodac users’ needs and requirementsStudie über die Bedürfnisse und Anforderungen der Eurodac-Benutzer
5242existence of the marriageBestand der Ehe
5243authorisation to enterEinreisegestattung
5244privileged accessbevorrechtigter Zugang
5245frontier crossing permitGrenzerlaubnis
5246geometric motifgeometrisches Motiv
5247in order to establish the likelihood of the reasonszur Glaubhaftmachung der Gründe
5248application to enter the territoryEinreisebegehren
5249angle of observationBlickwinkel
5250immediately effective decisionunaufschiebbare Verfügung
5251black lightschwarzes Licht
5252Member State which has agreed to allow a person to resideaufnahmebereiter Mitgliedstaat
5253surveillance by patrolling or stationing at…Überwachung in Form von Bestreifung und Postierung an..
5254complaintAnzeige
5255person apprehendedAufgriff
5256perforate numberingperforierte Nummerierung
5257retroreflective laminateretroreflektierende Sicherheitsfolie “Confirm 3m”
5258Chiefs of Communication (CFSP)Leiter – Nachrichtenübermittlung (GASP)
5259single textEinheitstext
5260WITSWITS
5261Community regime for the control of exports, transfer, brokering and transit of dual-use itemsGemeinschaftsregelung für die Kontrolle der Ausfuhr von Gütern und Technologien mit doppeltem Verwendungszweck
5262take into detentionin Abschiebehaft nehmen
5263baby bananaFeigenbanane
5264search for objectsSachfahndung
5265techniqueEinsatztechnik
5266instrumentalityTatmittel
5267collection and keeping of physical evidenceSpurensicherung
5268BW-related dual-use equipmentdual-use-Material in Bezug auf biologische Waffen
5269CW-related dual-use equipmentdual-use-Material in bezug auf chemische Waffen
5270chemical weapons precursorVorläuferstoff für chemische Waffen
5271NDVKernwaffeneinsatzmittel
5272racial harassmentrassistische Belästigung
5273illegally appropriated documentwiderrechtlich angeeignetes Grenzübertrittspapier
5274separate sheet inserted (in the document)Einlegeblatt
5275co-chairmen of the Minsk ConferenceKo-Vorsitzende der Minsker Konferenz
5276review meetingÜberprüfungstreffen
5277JPLEFGemeinsame Friedens- und Vollzugstruppen
5278JCCGemeinsame Kontrollkommission
5279house arrestHausarrest
5280European security architectureeuropäische Sicherheitsarchitektur
5281principle of sincere cooperationGrundsatz der loyalen Zusammenarbeit
5282White Paper on the preparation of the associated countries of Central and Eastern Europe for integration into the internal market of the UnionWeissbuch: Vorbereitung der assoziierten Staaten Mittel- und Osteuropas auf die Integration in den Binnenmarkt der Union
5283blank stickerBlankoetikette
5284fixed connectionStandverbindung
5285encrypted transmissionverschlüsselte Übermittlung
5286Agreement on Technical Barriers to TradeÜbereinkommen über technische Handelshemmnisse
5287ELDRELDR
5288the Union’s external actionauswärtiges Handeln der Union
5289UCLAF Integrated Information Management SystemUCLAF Integrated Information Management System
5290APSOAPSO
5291Partnership and Cooperation Agreement between the European Communities and their Member States and the Republic of BelarusAbkommen über Partnerschaft und Zusammenarbeit zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten einerseits und der Republik Belarus andererseits
5292PCA with KazakhstanAbkommen über Partnerschaft und Zusammenarbeit zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten und der Republik Kasachstan
5293Partnership and Cooperation Agreement between the European Communities and their Member States, of the one part, and the Kyrgyz Republic, of the other partAbkommen über Partnerschaft und Zusammenarbeit zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten und der Kirgisischen Republik
5294CASCUCASCU
5295Special Rapporteur on Torture and other Cruel, Inhuman or Degrading Treatment or PunishmentSonderberichterstatter über Folter
5296Directorate for Specific World RegionsDirektion Geographische Bereiche (I und II)
5297Committee on Technical Barriers to TradeAusschuss Technische Handelshemmnisse”
5298TEN-ETEN-E
5299soft drugsweiche Drogen
5300live capture for tenprintsdirekte Abnahme der Abdrücke aller zehn Finger
5301sensitivityEmpfindlichkeit
5302palm printHandflächenabdruck
5303European central fingerprints collectionzentrale europäische Sammlung betreffend Fingerabdrücke
5304order opening a data fileErrichtungsanordnung
5305implementing rulesDurchführungsbestimmung zu den Dateien
5306third bodyDrittstelle
5307obligation of discretion and confidentialityVerpflichtung zur Verschwiegenheit und Geheimhaltung
5308false imprisonmentFreiheitsberaubung
5309illicit trafficking in hormonal substances and other growth promotersillegaler Handel mit Hormonen und Wachstumförderern
5310common European defence policyGEVP
5311rescue taskRettungseinsatz
5312Modified Brussels Treatygeänderter Brüsseler Vertrag
5313EUROFOREUROFOR
5314EUROMARFOREUROMARFOR
5315Council act drawing up the Convention based on Article K.3 of the Treaty on European Union, on the establishment of a European Police Office (Europol)Rechtsakt des Rates über die Fertigstellung des Übereinkommens aufgrund von Artikel K.3 des Vertrags über die Europäische Union über die Errichtung eines Europäischen Polizeiamts (Europol-Übereinkommen)
5316Commissioner of the CBSS on Democratic Institutions and Human Rights, including the Rights of Persons belonging to MinoritiesKommissar des Ostseerats für demokratische Institutionen und Menschenrechte, einschließlich der Rechte von Personen, die Minderheiten angehören
5317UPFMEinheitliche Polizeitruppe für Mostar
5318cross-representation of Secretariatswechselseitige Einbeziehung der Sekretariate
5319identifying those assets and capabilities that the WEU will need in its future operationsBenennung derjenigen Mittel und Kapazitäten der WEU, die sie für ihre künftigen Operationen benötigt
5320equivalence agreementGleichstellungsabkommen
5321WEU Security AgreementGeheimschutzübereinkommen der WEU
5322vulnerability to fraudBetrugsanfälligkeit
5323generic planninggenerische Planung
5324SATCENWEU-Satellitenzentrum
5325remote sensing from the air or spaceFernerkundung mittels Luft- oder Satellitenaufnahmen
5326failure to present goods at the customs office of destinationNichtgestellung der betreffenden Waren bei der Bestimmungszollstelle
5327WEU Humanitarian Task ForceHumanitäre Einsatzgruppe der WEU
5328to associate all informationsalle Informationen vernetzen
5329electronic registerelektronische Datei
5330detection systemFahndungssystem
5331illicit trafficking in nuclear or radioactive materialsNuklearschmuggel
5332BALTRELOsteering
5333country of nationalityLand der Staatsangehörigkeit
5334Convention drawn up on the basis of Article K.3 of the Treaty on European Union, on the Protection of the European Communities’ Financial InterestsÜbereinkommen aufgrund von Artikel K.3 des Vertrags zur Gründung der Europäischen Union über den Schutz der finanziellen Interessen der Europäischen Gemeinschaften
5335aiding and abettingBeihilfe
5336effective, proportionate and dissuasive criminal penaltywirksame, angemessene und abschreckende Strafe
5337admission/transit of a personÜbernahme/Durchbeförderung
5338geographic working partygeografische Gruppe
5339The colour of the reproduction may not correspond exactly to that of the original. The detection of document fraud should not be based on colour comparison alone.Die Farbe dieser Reproduktion stimmt unter Umständen nicht genau mit der Farbe des Originals überein. Bei der Erkennung gefälschter Dokumente darf daher nicht nur von der Farbgestaltung ausgegangen werden.
5340genuineOriginal
5341FALSEFälschung
5342document fraudDokumentenbetrug
5343administration of revenueVerbuchung der Einnahmen
5344humanitarian missionhumanitäre Aufgabe
5345tasks of combat forces in crisis managementKampfeinsatz im Rahmen der Krisenbewältigung
5346ISGISG
5347standard of data protectionDatenschutzstandard
5348sighting and reportingFeststellung und Unterrichtung
5349application for refugee statusAntrag auf Anerkennung als Flüchtling
5350Convention based on article K.3 of the Treaty on European Union, on the Establishment of a European Police OfficeEuropol-Übereinkommen
5351RILORILO
5352value toleranceWerttoleranz
5353Declaration on the Enhancement of the Effectiveness of the Principle of Refraining from the Threat or Use of Force in International RelationsErklärung über die Verstärkung der Wirksamkeit des Grundsatzes der Unterlassung einer Androhung oder Anwendung von Gewalt in den internationalen Beziehungen
5354Principles of International cooperation in the detection, arrest, extradition and punishment of persons guilty of war crimes and crimes against humanityGrundsätze für die internationale Zusammenarbeit bei der Ermittlung, Festnahme, Auslieferung und Bestrafung von Personen, die Kriegsverbrechen und Verbrechen gegen die Menschlichkeit begangen haben
5355Measures to prevent international terrorism which endangers or takes innocent human lives or jeopardizes fundamental freedoms and study of the underlying causes of those forms of terrorism and acts of violence which lie in misery, frustration, grief and despair and which cause some people to sacrifice human lives, including their own, in an attempt to effect radical changesMassnahmen zur Verhinderung von internationalem Terrorismus, der das Leben unschuldiger Menschen bedroht oder vernichtet oder die Grundfreiheiten beeinträchtigt, sowie Untersuchung der tieferen Ursachen derjenigen Formen von Terrorismus und Gewalthandlungen, die in Elend, Enttäuschung, Leid und Verzweiflung wurzeln und manche Menschen dazu treiben, Menschenleben – einschliesslich ihr eigenes – zu opfern, um radikale Veränderungen herbeizuführen
5356legal documentsVerfahrensunterlagen
5357paper corePapierinlett
5358Resolution on the protection of witnesses in the fight against international organised crimeEntschliessung über den Schutz von Zeugen im Rahmen der Bekämpfung der internationalen Kriminalität
5359photographic/analytical data bankBild- und Analysedatenbank
5360EU-SADC Joint Steering Committeegemeinsamer Lenkungsausschuss
5361long-term residentdauerhaft Ansässige (n.f.)
5362ASEM SummitASEM-Gipfel
5363embezzlementUnterschlagung
5364GERGER
5365subsidy fraudSubventionsbetrug
5366breach of trustUntreue
5367forgery of documentsUrkundenfälschung
5368law on combating crimeVerbrechensbekämpfungsgesetz
5369cryptographic cardVerschlüsselungskarte
5370stock exchange and credit fraudBörsen- und Kreditbetrügereien
5371admission of residentsZulassung zum Zweck des längeren Aufenthalts
5372Final Act of the European Energy Charter ConferenceSchlussakte der Europäischen Energiechartakonferenz
5373airport intelligenceGewinnung von Erkenntnissen im Bereich Flugverkehr
5374maritime intelligenceGewinnung von Erkenntnissen im Bereich Seeverkehr
5375ecstasy profiling systemEcstasy Profiling System
5376administrative databaseDatenbank für den Verwaltungsbereich
5377security databaseDatenbank für den Sicherheitsbereich
5378test scriptsTest Skripts
5379dummy databaseSimulationsdatenbank
5380functionality and volumetric testingFunktions- und Kapazitätstests
5381system acceptanceSystemabnahme
5382ad hoc thematic meetings of ministersAd-hoc-Sitzungen von Ministern über bestimmte Themen
5383consular servicesKonsularstellen
5384Technical and Forensic Police Working PartyGruppe “Kriminaltechnik und -wissenschaft”
5385SFOAmt für schwere Finanzkriminalität
5386Grains Trade Convention, 1995Getreidehandels-Übereinkommen von 1995
5387civil partyPrivatbeteiligter
5388blinding laserBlendlaser
5389Europol Intelligence AnalystIntelligence-Analytiker von Europol
5390Crisis management centreLagezentrum
5391AEWAAEWA
5392Conference on the Great Lakes regionKonferenz über die Region der Grossen Seen
5393Euro-Mediterranean Agreement establishing an association between the European Communities and their Member States, of the one part, and the Republic of Tunisia, of the other partEuropa-Mittelmeerabkommen zur Gründung einer Assoziation zwischen der Europäischen Gemeinschaft und ihren Mitgliedstaaten einerseits und der Tunesischen Republik andererseits
5394development of original informationAufbereitung von Originalinformationen
5395phenomena analysisAnalyse der Erscheinungsformen
5396Member State of originentsendender Mitgliedstaat
5397freedom to manifest one’s religion in teaching, practice, worship and observancedie Freiheit, seine Religion oder Weltanschauung durch Gottesdienst, Unterricht oder Praktizieren von Bräuchen oder Riten zu bekennen
5398actor of persecutionUrheber der Verfolgung
5399CEPAMEPA
5400Certificate of EligibilityBescheinigung über die Flüchtlingseigenschaft
5401inclusion clausesEinbeziehungsklausel
5402place of commissionBegehungsort
5403conflicting requestsMehrheit von Auslieferungsersuchen
5404defusedelaborieren
5405associated countries of Central Europe and the Baltic Seaassoziierte Länder Mitteleuropas und der Ostsee
5406OSREinsatzraum
5407tactical intelligenceoperative Auswertung
5408operational intelligenceoperative Auswertung
5409investigation and intelligence task forcesStäbe für die Zusammenarbeit bei Ermittlungen und “Intelligence”
5410drug seizureSicherstellung von Drogen
5411project teamProjektgruppe
5412forensic laboratorykriminaltechnisches Labor
5413Management Board of the European Monitoring Centre on Racism and XenophobiaVerwaltungsrat der Europäischen Beobachtungsstelle für Rassismus und Fremdenfeindlichkeit
5414Scientific Committee of the European Monitoring Centre on Racism and Xenophobiawissenschaftlicher Ausschuss der Europäischen Beobachtungsstelle für Rassismus und Fremdenfeindlichkeit
5415danger ratingGefährlichkeit
5416Joint Audit Committeegemeinsamer Prüfungsausschuss
5417principle of assimilationPrinzip der Assimilierung
5418Informal Group of Experts responsible for studying the options for a European armaments policyinformelle Sachverständigengruppe zur Prüfung der Optionen einer europäischen Rüstungspolitik
5419ILEAILEA
5420Global Conference on the Sustainable Development of Small Island Developing StatesWeltkonferenz über die nachhaltige Entwicklung der kleinen Inselstaaten unter den Entwicklungsländern
5421Urban Safety AgreementSicherheitskooperationsvereinbarung
5422institutions, bodies, offices and agenciesOrgane, Einrichtungen und sonstige Stellen
5423General Memorandum of Understanding on the Co-location of Diplomatic and Consular MissionsRahmenvereinbarung über die gemeinsame Unterbringung diplomatischer und konsularischer Vertretungen
5424zero yield option for all nuclear weapon testsOption für Sprengkraft-Schwellenwert Null
5425development cooperationEntwicklungszusammenarbeit
5426the maintenance of law and orderAufrechterhaltung der öffentlichen Ordnung
5427EMSEWS
5428tender procedureTenderverfahren
5429scheduled substanceerfasster Stoff
5430Protocol, drawn up on the basis of Article K.3 of the Treaty on European Union, on the interpretation, by way of preliminary rulings, by the Court of Justice of the European Communities of the Convention on the establishment of a European Police OfficeProtokoll aufgrund von Artikel K.3 des Vertrags über die Europäische Union betreffend die Auslegung des Übereinkommens über die Errichtung eines Europäischen Polizeiamts durch den Gerichtshof der Europäischen Gemeinschaften im Wege der Vorabentscheidung
5431International Tropical Timber Agreement, 1994Internationales Tropenholz-Übereinkommen, 1994
5432Central Office for the Prevention of Art TheftsZentralstelle für die Verfolgung des Diebstahls von Kunstwerken und -gegenständen
5433forerunner countryInitiativland
5434nullity of a marriageUngültigkeit einer Ehe
5435ancillary decisions on the exercise of parental authorityEntscheidungen in Folgesachen über die Ausübung der elterlichen Sorge
5436greater interest of the childWohl der Kinder
5437actions relating to divorce, separation and annulment of marriageAnträge auf Ehescheidung, Trennung ohne Auflösung des Ehebandes oder Ungültigerklärung einer Ehe
5438standard travel documentStandardreisedokument
5439Europol Computer System Project BoardProjektausschuss “Europol-Computersystem”
5440ballistic profilingErstellung ballistischer “Profile”
5441chemical profilingErstellung chemischer “Profile”
5442personnel filing systemPersonalarchiv
5443director responsible for police trainingLeiter der Polizeischule
5444lexicon of police termsLexikon der polizeilichen Fachterminologie
5445right of representationVertretungsrecht
5446PMRPMR
5447TETRATETRA
5448epidermal ridge datadaktyloskopische Spuren
5449ridge pattern analysisDaktyloskopie
5450Multidisciplinary Group on CorruptionMultidisziplinäre Gruppe “Bestechung”
5451ATVVFT
5452International Ministerial Conference for Economic Assistance to the Palestinian PeopleMinisterkonferenz über Wirtschaftshilfe für das palästinensische Volk
5453La Gomera DeclarationErklärung von Gomera
5454ASEMASEM
5455penal institutionHaftanstalt
5456administrative detention centreGewahrsamseinrichtung
5457ELECELEC
5458NPBReichspolizeiamt
5459Migration AgencySchwedisches Migrationsamt
5460SE
5461premises for detentionSchubhafträume
5462BEPGGrundzüge der Wirtschaftspolitik
5463Human Rights ObserverMenschenrechtsbeobachter
5464Joint Political DeclarationGemeinsame Politische Erklärung
5465the Syrian trackVerhandlungsweg
5466NTANTA
5467exercise WEU “CRISEX 95-96”Übung “WEU CRISEX 95-96”
5468accompanied bag servicespersönlicher Kurier
5469allelicallel
5470network configurationVermaschung des Netzes
5471compilation of allelic frequencies of genetic markersZusammenstellung der am häufigsten vorkommenden, durch genetische Marker bestimmbaren Allele
5472population database of DNA polymorphisms for police purposesDNA-Analysedatei
5473Law on Constitution of CourtsGVG
5474summary assessing the external and internal threat represented by terrorism to Member States of the European UnionSynthese-Dokument zur Bewertung der aussen- und innenpolitischen Gefahr, die der Terrorismus für die Mitgliedstaaten der Europäischen Union darstellt
5475publicising acts and other texts adopted in the field of asylum and immigrationZugang der Öffentlichkeit zu den in den Bereichen Asyl und Einwanderung verabschiedeten Rechtsakten und sonstigen Schriftstücken
5476detaining agencyanfragende Dienststelle
5477past recordVorstrafen
5478VSAReisevisum
5479CLPSammelpass
5480STCUukrainisches Wissenschafts- und Technologiezentrum
5481CARIFORUMCARIFORUM
5482petty urban crimestädtische Alltagskriminalität
5483US-EU Action PlanGemeinsamer Aktionsplan EU-USA
5484PICFriedensimplementierungsrat
548593 + 2 programme93 + 2-Programm
5486defence postureVerteidigungsdispositiv
5487the revised Lomé IV Conventiongeänderte Fassung des Vierten Abkommens von Lomé
5488Barcelona DeclarationErklärung von Barcelona
5489Conference on Policing and Petty Urban Crime in EuropeKonferenz über Polizei und städtische Alltagskriminalität in Europa
5490extreme religious cultsextremistische Sekten
5491storage controlSpeicherkontrolle
5492Agreement amending the Fourth ACP-EC Convention of LoméAbkommen von Mauritius
5493alleged crimeTatvorwurf
5494suspicious transactionverdächtige Transaktion
5495BOCBritischer überseeischer Bürger
5496a just and viable solution to the question of Cyprus on the basis of a bi-zonal and bi-community federationeine gerechte und tragfähige Lösung der Zypern-Frage, die auf einer Föderation von zwei Gebieten und zwei Gemeinschaften basiert
5497specific manifestations of the forms of crime listed in the Annexspezifische Ausprägungen der im Anhang aufgeführten Formen der Kriminalität
5498Expert Group on DrugsGruppe der Drogensachverständigen
5499transit for the purposes of expulsionTransit zum Zwecke der Rückführung
5500alert and emergency procedure for burden-sharing with regard to the admission and residence of displaced persons on a temporary basisWarn- und Dringlichkeitsverfahren zur Lastenverteilung hinsichtlich der Aufnahme und des vorübergehenden Aufenthalts von Vertriebenen
5501Conference on European police forces and urban crimeKonferenz über die europäischen Polizeien und die Kriminalität in den Städten
5502Andean Presidential CouncilRat der Präsidenten der Andenländer
5503the San José dialogueSan-José-Dialog
5504critical dialoguekritischer Dialog
5505aggregate contracting rateGesamtanteil der vertraglich gebundenen Mittel
5506Euro-Mediterranean Committee for the Barcelona processEuropa-Mittelmeer-Ausschuss für den Barcelona-Prozess
5507pre-borderim Grenzvorbereich
5508Ilascu groupIlascu-Gruppe
5509active repentancetätige Reue
5510reduced sentenceStrafmilderung
5511certificateZustellungszeugnis
5512convention on the admission of nationals of third countriesÜbereinkommen über die Zulassung der Angehörigen von Drittstaaten
5513main destinationHauptreiseziel
5514Council of the EntenteRat der Entente
5515analysis groupAnalysegruppe
5516authorised liaison officerermächtigter Verbindungsbeamter
5517Chairman of the Joint Supervisory BodyVorsitzender der gemeinsamen Kontrollinstanz
5518DirectorDirektor
5519Deputy Directorstellvertretender Direktor
5520Europol staff regulationsStatut der Bediensteten von Europol
5521CSPLSP
5522crime against life, limb or personal freedomStraftaten gegen Leben, körperliche Unversehrtheit und Freiheit
5523illicit trade in human organs and tissueillegaler Handel mit Organen und menschlichem Gewebe
5524hostage takingGeiselnahme
5525crime against property or public goods including fraudStraftaten gegen fremdes Vermögen und staatliches Eigentum sowie Betrug
5526illicit trafficking in cultural goods, including antiquities and works of artillegaler Handel mit Kulturgütern, einschließlich Antiquitäten und Kunstgegenstände
5527illicit trafficking in arms, ammunition and explosivesillegaler Handel mit Waffen, Munition und Sprengstoffen
5528illicit trafficking in endangered plant species and varietiesillegaler Handel mit bedrohten Pflanzen- und Baumarten
5529illegal money-laundering activitiesGeldwäschehandlungen
5530filing referenceAktenzeichen
5531effect of proof or a presumptionBindungswirkung des Nachweises und der Glaubhaftmachung
5532analysis projectAnalyseprojekt
5533draw up a report for a retrieval of personal dataden Abruf von personenbezogenen Daten protokollieren
5534NBPANBPA
5535football hooliganismFussballrowdytum
5536economic asylum seekerWirtschaftsflüchtling
5537Conference of Ministers and Senators for the Interior of the LänderStändige Konferenz der Innenminister und -senatoren
5538European Union Handbook of Genuine Identity, Travel and Residence DocumentsHandbuch “Echte Personal-, Reise- und Aufenthaltsdokumente” der Europäischen Union
5539Subcommittee on Legal and Institutional AspectsUnterkommission “Rechtliche und institutionelle Aspekte”
5540fraud affecting the European Communities’ financial interestsBetrug zum Nachteil der finanziellen Interessen der Europäischen Gemeinschaften
5541MIPMehrjahresrichtprogramm
5542serious fraudschwerer Betrugsfall
5543minor fraudminderschwerer Betrugsfall
5544tax offenceAbgabendelikt
5545customs duty offenceZolldelikt
5546enforcement of sentences passed in another Member StateVollstreckung von Urteilen, die in einem anderen Mitgliedstaat ergangen sind
5547TAIEXInformationsaustausch und technische Unterstützung
5548freedom of thought, conscience and religionGedanken-, Gewissens- und Religionsfreiheit
5549non-challenge visitBesuch ohne Verdachtshintergrund
5550fingerprint codeFingerabdruckcode
5551basic patternGrundmuster
5552fingerprint imageFingerabdruckbild
5553Conference of European Directors of Police Training CollegesKonferenz der Leiter der europäischen Polizeiakademien
5554EU Special Representative for the African Great Lakes RegionEU-Sonderbeauftragter für die afrikanische Region der Großen Seen
5555(the) scene of the crimeTatort
5556ninhydrinNinhydrin
5557stewardOrdner
5558supervisorOrdner
5559uprooted peopleentwurzelte Bevölkerungsgruppen
5560Basic TreatyGrundlagenvertrag
5561motoring offenceVerkehrsdelikt
5562MEPPFriedensprozess im Nahen Osten
5563Ad hoc Working Party on Latin America and the Caribbean (Drugs)Sachverständigengruppe “Lateinamerika/Karibik” (Drogen)
5564document titleTitelbezeichnung eines Dokuments
5565effectivenessLeistungsfähigkeit
5566Police Staff CollegeP.F.A.
5567operational support and coordination roomEinsatz- und Koordinationsraum
5568street level valueSchwarzmarktwert
5569criminal groupsStraftätergruppen
5570Legal Service contributionBeitrag des Juristischen Dienstes
5571Summit of Peacemakers (Sharm el Sheikh)Gipfel der Friedensstifter (Scharm al Scheich)
5572BTWC Review ConferenceKonferenz zur Überprüfung des BWÜ
5573Special Conference of the States Parties to the BTWCSondervertragsstaatenkonferenz
5574verification protocolVerifikationsprotokoll
5575geographical directorgeographisch zuständiger Direktor
5576political dialogue meetingTagung im Rahmen des politischen Dialogs
5577merged working partyfusionierte Gruppe
5578executive tasksexekutive Aufgaben
5579constructive abstentionkonstruktive Stimmenthaltung
5580LCCKZO
5581CEFTAMitteleuropäische Freihandelszone
5582preliminary inquiryErmittlungen
5583quadripartite meetingVierertreffen
5584institution-buildingAufbau von Institutionen
5585red noticeInterpol-Rotecke
5586VICLASAnalysesystem zur Serienzusammenführung von Gewaltverbrechen (2)
5587national citizenshipnationale Staatsbürgerschaft
5588a serious and persistent breachschwerwiegende und anhaltende Verletzung
5589exchange of best practice in law enforcementAustausch bewährter Praktiken im Bereich Strafverfolgung
5590external economic policyAußenwirtschaftspolitik
5591multilateralismMultilateralismus
5592Mr or Ms CFSPMonsieur PESC
5593direct or indirect sale of narcotic drugsunmittelbare oder mittelbare Abgabe von Suchtstoffen
5594AEBFAEBF
5595Conference on Trafficking in Women for purposes of Sexual ExploitationKonferenz über Frauenhandel zum Zweck der sexuellen Ausbeutung
5596Palestinian CharterPLO-Charta
5597Tripartite Action Plan on Revenues, Expenditures and Donor Funding for the Palestinian AuthorityDreiparteien-Aktionsplan für die Palästinensische Autonomiebehörde über Einkünfte, Ausgaben und die Finanzierung durch Geberländer
5598the flow of money via airportsGeldtransfer über Flughäfen
5599Informatics Project BoardProjektgruppe Informatik
5600container trafficDrogenschmuggel in Containern
5601coverLegende
5602centre of special competence to combat terrorismZentrum mit Fachkompetenz für die Terrorismusbekämpfung
5603seminar on the use of data transmission networks by terrorist groupsSeminar über die Benutzung der Telematiknetze durch terroristische Gruppen
5604closer cooperationVerstärkte Zusammenarbeit
5605collective defencekollektive Verteidigung
5606capacity for external actionexterne Handlungsfähigkeit
5607cross-border hot pursuitNacheile
5608MREmittelfristige Schätzung
5609black tarTeer
5610Orient HouseOrient House
5611junior officerNachwuchsbeamter
5612framework partnership agreementPartnerschaftsrahmenvertrag
5613joint police headquartersgemeinsames Polizeihauptquartier
5614Pipeline ConferencePipeline-Konferenz
5615master planGesamtplan
5616CFSP decisionGASP-Beschluss
5617discharge from repaymentBefreiung von der Verpflichtung zur Rückzahlung
5618Intergovernmental Conference Group of Ministers’ RepresentativesGruppe der RK-Beauftragten
5619guaranteed minimum amountgarantierter Mindestbetrag
5620TRACECATRACECA
5621embossed in cross-grain patternRasterprägung
5622photographically integratedfotografisch integriert
5623RSSRSS
5624EU-Turkey Joint Consultative CommitteeGemischter Beratender Ausschuss EU-Türkei
5625integration of the WEU into the UnionIntegration der WEU in die Union
5626Union’s external policydie Außenpolitik der Union
5627Internal Agreement between the Representatives of the Governments of the Member States, meeting within the Council, on the financing and administration of Community aid under the Second Financial Protocol to the Fourth ACP-EC ConventionInternes Abkommen zwischen den im Rat vereinigten Vertretern der Regierungen der Mitgliedstaaten über die Finanzierung und Verwaltung der Hilfen der Gemeinschaft im Rahmen des zweiten Finanzprotokolls des vierten AKP-EG-Abkommens
5628Executive Board of the European Monitoring Centre on Racism and XenophobiaExekutivausschuss der Europäischen Beobachtungsstelle für Rassismus und Fremdenfeindlichkeit
5629hook clauseVerzahnungsklausel
5630Schengen acquisSchengen-Besitzstand
5631GROTIUS ProgrammeFörder- und Austauschprogramm für die Rechtsberufe
5632Programme of training, exchanges and cooperation in the field of identity documents (Sherlock)Ausbildungs-, Austausch- und Kooperationsprogramm im Bereich der Ausweisdokumente
5633industrial returnGegenleistungen für die Industrie
5634Protocol 10 on sustainable management of forest resourcesProtokoll Nr.10 über die nachhaltige Bewirtschaftung der Forstressourcen
5635international peace and securityWeltfrieden und internationale Sicherheit
5636security goodsicherheitsrelevantes Gut
5637civil armsWaffen für zivile Verwendungszwecke
5638sensitive goodsempfindliche Güter
5639cabaret visaTänzerinnenvisum
5640seal on stickerKlebesiegel
5641passport cardPasskarte
5642grain finishLederimitation
5643Platform for Cooperative SecurityOSZE-Plattform für kooperative Sicherheit
5644Basic Agreement for Eastern SlavoniaGrundsatzabkommen für Ostslawonien
5645Euromediterranean system of mitigation, prevention and management of natural and man-made disastersEuromed-System für die Verhütung, Milderung und Bewältigung von Naturkatastrophen und vom Menschen verursachte Katastrophen
5646Working Group on Arbitrary DetentionSondergruppe der Vereinten Nationen für willkürliche Festnahmen und Inhaftierungen
5647customs cooperationZusammenarbeit im Zollwesen, Zusammenarbeit der Zollverwaltungen
5648High Representative for the CFSPHoher Vertreter für die GASP
5649DTRCISDTRCIS
5650acts of violence against the life, physical integrity or liberty of a personGewalttat gegen das Leben, die körperliche Unversehrtheit oder die Freiheit einer Person
5651terrorist activities against life, limb, personal freedom or propertyterroristische Handlungen gegen Leben, kõrperliche Unversehrtheit und persõnliche Freiheit sowie gegen Sachen
5652CRIPCRIP
5653EC-Malta Trade and Economic Cooperation CommitteeAusschuss für Handel und wirtschaftliche Zusammenarbeit EG-Malta
5654Joint Committee on Trade and Commercial and Economic CooperationGemischter Ausschuss für den Handel und die handelspolitische und wirtschaftliche Zusammenarbeit
5655IDERIDER-Programm
5656PTAPPTAP
5657Euro-Mediterranean Agreement establishing an Association between the European Communities and their Member States, of the one part, and the State of Israel, of the other partEuropa-Mittelmeer-Abkommen zur Gründung einer Assoziation zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten einerseits und dem Staat Israel andererseits
5658domestic cultivationDrogenanbau im Inland
5659REDTRACREDTRAC
5660CPLPCPLP
5661ICITAPICITAP
5662Youth diversion projectssinnvolle Alternativangebote für Jugendliche
5663Vision of Europolkünftige Gestaltung von Europol
5664Working Group EUROArbeitsgruppe EURO
5665Special Envoy of the European Union in the city of MostarSonderbeauftragter der Europäischen Union in der Stadt Mostar
5666EU Rear PartyAbwicklungsstab für den Abbau der EU-Verwaltung der Stadt Mostar
5667consistency of the Union’s external actionKohärenz des auswärtigen Handelns der Union
5668Petersberg DeclarationPetersberg-Erklärung
5669improvised weaponryunkonventionelle Waffen
5670CPSStaatsanwaltschaft
5671DCS 1800DCS 1800
5672confidential materialVerschlusssachen
5673DNRnationale Ermittlungsdirektion
5674Directory of Specialised Counter Terrorist Competences, Skills and ExpertiseVerzeichnis der besonderen Fähigkeiten und Fachkenntnisse auf dem Gebiet der Terrorismusbekämpfung
5675World Congress against Commercial Sexual Exploitation of ChildrenWeltkongress gegen die gewerbsmässige sexuelle Ausbeutung von Kindern
5676Model Treaty on Mutual Assistance in Criminal MattersMustervertrag über die Rechtshilfe in Strafsachen
5677pre-precursorVorstoff für Drogengrundstoffe
5678Agreement between the European Community and the Republic of Bolivia on precursors and chemical substances frequently used in the illicit manufacture of narcotic drugs or psychotropic substancesAbkommen zwischen der Europäischen Gemeinschaft und der Republik Bolivien über Grundstoffe und chemische Stoffe, die häufig für die unerlaubte Herstellung von Suchtstoffen oder psychotropen Substanzen verwendet werden
5679directory of specialised competences, skills and expertise in the matter of the fight against international organized crimeVerzeichnis der besonderen Fähigkeiten und Fachkenntnisse auf dem Gebiet der Bekämpfung der internationalen organisierten Kriminalität
5680Coordinating Aliens Chamber of the District Court of The HagueKammer zur Wahrung der Rechtseinheit (Ausländerrecht)
5681life sentence or detention orderlebenslange Strafe oder Massregel der Sicherung oder Besserung
5682measure of clemencyVollstreckungserleichterung
5683illegal gamblingunerlaubte Veranstaltung von Glücksspielen
5684pusherPusher
5685cultivation of drugsDrogenanbau
5686the offence is classified as an association to commit offencesdie Straftat erfüllt den Straftatbestand der kriminellen Vereinigung
5687ASEFASEF
5688collective dangerGemeingefahr
5689measure restricting the personal libertydie persönliche Freiheit beschränkende Massnahme
5690measure in lieu of a financial penaltyvermögensrechtliche Massnahme
5691diplomatic and consular missionsdiplomatische und konsularische Vertretungen
5692AFSOUTHAFSOUTH
5693qualified membershipeingeschränkte Mitgliedschaft
5694recording of dataDateneingabe
5695alignment or combinationKombination oder Verknüpfung
5696eavesdropping operationsgrosser Lauschangriff
5697Agreement on cooperation in the sea fisheries sector between the European Community and the Kingdom of MoroccoAbkommen über die Zusammenarbeit in der Seefischerei zwischen der Europäischen Gemeinschaft und dem Königreich Marokko
5698Euro-Mediterranean Agreement establishing an Association between the European Communities and their Member States, of the one part, and the Kingdom of Morocco, of the other partEuropa-Mittelmeer-Abkommen zur Gründung einer Assoziation zwischen den Europäischen Gemeinschaften und ihren Mitgliedstaaten einerseits und dem Königreich Marokko andererseits
5699Financial Regulation concerning reconstructionVerordnung über die Finanzierung des Wiederaufbaus
5700mobile search squadmobile Sondereinheit
5701mobile surveillance patrolmobile Observationsgruppe
5702mobile border patrolGrenzstreife
5703Convention established by the Council in accordance with Article 34 of the Treaty on European Union, on Mutual Assistance in Criminal Matters between the Member States of the European UnionÜbereinkommen über die Rechtshilfe in Strafsachen zwischen den Mitgliedstaaten der Europäischen Union
5704necessities of lifeGrundbedürfnisse
5705core nominalnamentlich bekannter Haupttäter, namentlich erfasste Hauptfigur
5706caveatEinspruch
5707Basic Agreement on the Region of Eastern Slavonia, Baranja and Western SirmiumGrundsatzabkommen für Ostslawonien, die Baranja und West-Syrmien
5708MFAAußenministerium
5709PSTeilnehmerstaat
5710MPCMPZ
5711non-originating productNichtursprungsware
5712illegal and harmful content on the Internetillegale und schädliche Inhalte im Internet
5713electronic harassmentelektronische Belästigung
5714breach of copyrightVerletzung des Urheberrechts
5715hot-lineMeldestelle
5716parental control programProgramm zur elterlichen Kontrolle
5717blacklistingErstellung von schwarzen Listen
5718hardship postHärteposten
5719covert investigationverdeckte Ermittlungen
5720Protocol drawn up on the basis of Article K.3 of the Treaty on European Union to the Convention on the protection of the European Communities’ financial interestsProtokoll aufgrund von Artikel K.3 des Vertrags über die Europäische Union zum Übereinkommen über den Schutz der finanziellen Interessen der Europäischen Gemeinschaften
5721PECSPECS
5722scene of crime forensic investigation and analysiskriminaltechnische Tatortbesichtigung und Tatortbefundaufnahme
5723photo-analytical database on drugsDatenbank zur photoanalytischen Erfassung von Drogen
5724vote by separate housesAbstimmung in getrennten Kammern
5725Europol Security OfficerEuropol-Sicherheitsbeauftragter
5726counter-eavesdroppingAbhörschutzmassnahme
5727drug trafficking offenceDrogenhandelsdelikt
5728rehabilitation of drug addictsReintegration ehemaliger Drogenabhängiger
5729enforceable decisionvollziehbare Entscheidung
5730voluntary self-regulatory codeVerhaltenskodex zur freiwilligen Selbstkontrolle
5731police trainingpolizeiliche Aus- und Fortbildung
5732market access strategyMarktzugangsstrategie
5733suspect involved in organised crimeOK-Verdächtiger
5734range of criminal activitiesdeliktsübergreifende Verhaltensweisen
5735shiprider agreementVereinbarung über Schiffsbegleitung
5736declaration as to needs of the serviceGebotenheitserklärung
5737Centre of competenceFachzentrum
5738gluedKlebstoff (mit)
5739presumption of nationalityGlaubhaftmachung der Staatsangehörigkeit
5740cross-border investigation methodsgrenzüberschreitende Ermittlungsmethoden
5741day-fineTagessatz
5742euro unitEuro-Einheit
5743EDTIBEDTIB
5744peer pressureGruppenzwang
5745CEPACEPA
5746local ownershipEigenverantwortung der örtlichen Akteure
5747EEOEuropäischer Vollstreckungstitel
5748OISINOISIN
5749WEAOWEAO
5750advisory serviceAufklärung
5751EU Data Protection Commissioners Working Party on PoliceGruppe der EU-Datenschutzbeauftragten für den Bereich Polizei
5752cross-pillarsäulenübergreifend
5753enabling environmentgünstige Rahmenbedingungen
5754MIBHMission der Vereinten Nationen in Bosnien und Herzegowina
5755inhalantSchnüffelstoff
5756High-Level Group on Organised CrimeHochrangige Gruppe “Organisierte Kriminalität”
5757uniform format for residence permitseinheitlicher Aufenthaltstitel
5758internal or generalised armed conflictsmit Gewalt verbundener innerer oder allgemeiner Konflikt
5759DGSCGeneraldirektion “Dienste am Bürger”
5760duplication of a databaseNeuauflage einer Datenbank
5761German-Czech Declaration on the Mutual Relations and their Future DevelopmentDeutsch-tschechische Erklärung über die gegenseitigen Beziehungen und deren künftige Entwicklung
5762Directory of Centres of ExcellenceVerzeichnis der Fachdienststellen
5763law enforcement agencySicherheitsexekutive
5764AFSJRFSR
5765to disappear to an unknown destinationuntertauchen
5766closing remarksSchlussbemerkungen
5767new tradeable public debtneue handelbare Schuldtitel der öffentlichen Hand
5768EUCLIDEUCLID
5769easingErleichterung
5770exchange of letters recording the common understanding onBriefwechsel zur Protokollierung der Verständigung über
5771assimilationAssimilation
5772SGPSWP
5773Customs 2007Aktionsprogramm für das Zollwesen in der Gemeinschaft
5774IPAPAktionsplan zur Investitionsförderung
5775international areas of airportsTransitzone der Flughäfen
5776POCAnlaufstelle
5777agent provocateur(polizeilicher) Lockspitzel
5778active ingredients with narcotic propertiesStoffe mit Suchtgiftwirkung
5779EU-only agreementreines EU-Abkommen
5780SARSAR
5781refused alienzurückgewiesener Ausländer
5782OCUAKE
5783friends of LebanonFreunde des Libanon
5784Euro-Mediterranean Interim Association AgreementEuropa-Mittelmeer-Interimsassoziationsabkommen über Handel und Zusammenarbeit
5785CINCSOUTHCINCSOUTH
5786subject dataDaten zur Zielperson
5787HROAGHROAG
5788Agenda 2000Agenda 2000
5789qualified accessionBeitritt mit Einschränkungen
5790closed meetingnichtöffentliche Sitzung
5791guiding principles of the two-year civilian consolidation plan of the peace processLeitprinzipien des zweijährigen Plans zur zivilen Konsolidierung des Friedensprozesses
5792PICKonferenz zur Umsetzung des Friedens (Londoner Konferenz)
5793MDGGruppe der Militärischen Delegierten
5794WELGWELG
5795Institute for Security StudiesISS
5796EDEMEDEM
5797Armaments SecretariatRüstungssekretariat
5798Dayton Agreement on implementing the Federation of Bosnia and HerzegovinaÜbereinkommen von Dayton über die Schaffung der Föderation Bosnien und Herzegowina
5799Human Rights ChamberMenschenrechtskammer
5800UNCIVPOLCIVPOL
5801quartering areaKasernierungszone
5802United Nations consolidated inter-agency appeal for Angolakonsolidierter interinstitutioneller Appell der Vereinten Nationen für Angola
5803International Civilian Mission in HaitiInternationale Zivilmission in Haiti
5804dental chartingZahnstatus
5805voice identificationStimm-Erkennung
5806MoCoMOCO
5807force generationKräfteaufstellung
5808political controlpolitische Kontrolle
5809military mine clearancemilitärisches Minenräumen
5810force deploymentDislozierung von Kräften
5811assets and capabilitiesMittel und Fähigkeiten
5812GEPgenerischer Plan
5813follow-on operationFolgeeinsatz
5814Euro-Mediterranean Charter for Peace and StabilityCharta für Frieden und Stabilität in der Europa-Mittelmeer-Region
5815complementary forms of protectionsubsidiärer Schutz
5816minutiaeFingerabdruckmerkmale
5817Incentive and Exchange Programme for persons responsible for combating trade in human beings and sexual exploitation of childrenAnreiz- und Austauschprogramm für Verantwortliche für die Bekämpfung von Menschenhandel und sexueller Ausbeutung von Kindern
5818Logo ProjectLogo-Projekt
5819Incentive and exchange programme for persons responsible for combating trade in human beings and the sexual exploitation of childrenFörder- und Austauschprogramm für Personen, die für Massnahmen gegen den Menschenhandel und die sexuelle Ausbeutung von Kindern zuständig sind
5820ECOWAS Committee of Nine on LiberiaNeuner-Ausschuss für Liberia der ECOWAS
5821Joint Consultative CommitteeParitätischer Beratender Ausschuss
5822meeting of the Association CouncilTagung des Assoziationsrates
5823Operational Activities segment of ECOSOCden operativen Aktivitäten gewidmeter Teil der WSR-Tagung
5824humanitarian disasterhumanitäre Katastrophe
5825field representativeVertreter im Feld
5826high-level segment with Ministerial participationTagungsteil auf hoher Ebene mit Ministerbeteiligung
5827criminal policyKriminalpolitik
5828identification processFeststellung, wer bei dem geplanten Referendum über die Westsahara stimmberechtigt sein soll
5829foreign elementAuslandsbezug
5830penaltyStrafandrohung
5831ncDNAnicht codierender Teil der DNA
5832stolen, misappropriated or lostgestohlen, unterschlagen oder sonst abhandengekommen
5833Advisory MissionBeratende Mission
5834factually incorrect or unlawfully storedunrichtig sein oder unrechtmäßig gespeichert worden sein
5835Advance TeamVorbereitungsteam
5836Political and Security Partnershippolitische Partnerschaft und Sicherheitspartnerschaft
5837speed-ballSpeedball
5838Committee of Experts on crime in CyberspacePC-CY
5839SOMTITreffen hoher Beamter für Handels- und Investitionsfragen
5840Working Party on the European Enforcement OrderArbeitsgruppe “Europäischer Vollstreckungstitel”
5841EODEOD
5842Vision GroupAsien-Europa-Gruppe “Perspektiven”
5843armaments equipment produced through cooperative projectskoproduzierte Rüstungsgüter
5844operative powersoperative Befugnisse
5845Rules of Procedure of the ACP-EC Council of MinistersGeschäftsordnung des AKP-EG-Ministerrates
5846prohibited armverbotene Waffe
5847matcherMatch-Funktion
5848ring-fencingEinzelabschirmung
5849early oilearly oil
5850main oilmain oil
5851Recommendation (92) 1 of 10 February 1992 of the Council of Europe Committee of Ministers on the use of Analysis of Deoxyribonucleic Acid (DNA) within the framework of the criminal justice systemEmpfehlung (92) 1 des Ministerkomitees des Europarats vom 10. Februar 1992 über die Anwendung der Analyse der Desoxyribonukleinsäure (DNA) im Rahmen der Strafrechtspflege
5852EAPCEAPC
5853INOGATEINOGATE
5854BSTFTask Force “Organisierte Kriminalität im Ostseeraum”
5855Budapest ProcessBerlin/Budapest-Prozess
5856National Police Agencynationale Polizei
5857MNPFmultinationale Schutztruppe
5858control sampleProbe einer identifizierten Person
5859case stainam Tatort gesicherte Probe einer nicht identifizierten Person
5860mixed stainProbe mehrerer Personen
5861central bodyZentralstelle
5862autonomous territorial organisationautonome Gebietskörperschaft
5863judicial officerAmtsperson
5864MAPEMAPE
5865ATSATS
5866Hungarian National Interest Conciliation CouncilUngarischer Rat für nationalen Interessenausgleich
5867missing and unidentified personsvermisste Personen und nicht identifizierte Personen
5868IchkeriaItschkeria
5869Assistant Directorbeigeordneter Direktor
5870declaration triggerMeldeauslöser
5871declaration formatMeldeformat
5872on-site measureVor-Ort-Massnahme
5873on-site inspectionVor-Ort-Überprüfung
5874Convention drawn up on the basis of Article K.3 of the Treaty on European Union, on the service in the Member States of the European Union of judicial and extrajudicial documents in civil or commercial mattersÜbereinkommen aufgrund von Artikel K.3 des Vertrags über die Europäische Union über die Zustellung gerichtlicher und aussergerichtlicher Schriftstücke in Zivil- oder Handelssachen in den Mitgliedstaaten der Europäischen Union
5875solidarity principleGrundsatz der Solidarität
5876enclaved personsEnklavenbevölkerung
5877EUROMESCOEuroMeSCo
5878translation supplied by…von … vorgelegte Übersetzung
5879child escort agencyKinderbegleitagentur
5880chemical impurity profilingErstellung chemischer Profile anhand von Verunreinigungen
5881cooperative securitykooperative Sicherheit
5882nuclear postureNukleardispositiv
5883conventional force deploymentsDislozierung konventioneller Streitkräfte
5884JCSOGemeinsamer Ausschuss hoher Beamter
5885Second Protocol, drawn up on the basis of Article K.3 of the Treaty on European Union, to the Convention on the protection of the European Communities’ financial interestsZweites Protokoll aufgrund von Artikel K.3 des Vertrags über die Europäische Union zum Übereinkommen über den Schutz der finanziellen Interessen der Europäischen Gemeinschaften
5886public body in the exercise of State authorityHoheitsbetrieb
5887KEDO Executive BoardExekutivrat der KEDO
5888public benefitsöffentliche Zuwendungen
5889seizure, confiscation or removal of the instruments and proceeds of fraudBeschlagnahme, Einziehung oder Entziehung der Tatinstrumente und Erträge aus dem Betrug
5890Explanatory report on the Convention on the protection of the European Communities’ financial interestsErläuternder Bericht zum Übereinkommen über den Schutz der finanziellen Interessen der Europäischen Gemeinschaften
5891Pre-accession PactVorbeitrittsvereinbarung
5892centres of excellence conceptKonzept der Fachdienststellen
5893security classification of contributions to the directoryVerschlusssachenkennzeichnung der Beiträge zum Verzeichnis
5894exchange of DNA analysis resultsAustausch von DNS-Analyseergebnissen
5895abuse of childrenKindesmisshandlung
5896traffic of young peopleHandel mit Kindern und Jungendlichen
5897child abuse networkKinderpornographiering
5898forced subjection of personsUnterwerfung von Personen
5899sexual assault of minorssexuelle Gewalt gegenüber Minderjährigen
5900traffic in child pornographic materialsHandel mit kinderpornographischem Material
5901deficit reductionDefizitabbau
5902PSCErmächtigung zum Zugang zu Verschlusssachen
5903cohabitation(eheliche) Lebensgemeinschaft
5904airport transit arrangementsTransit auf Flughäfen
5905security packageSicherheitsmassnahmenpaket
5906common international agenda on Albaniagemeinsame internationale Agenda für Albanien
5907Agenda 2000 – “The Challenge of Enlargement”Die Erweiterung der Union – eine Herausforderung
5908Joint CommitteeGemischter Ausschuss
5909PIC Steering BoardLenkungsausschuss des Friedensimplementierungsrats
5910Protocol, drawn up on the basis of Article K.3 of the Treaty on European Union and Article 41(3) of the Europol Convention, on the privileges and immunities of Europol, the members of its organs, the deputy directors and employees of EuropolProtokoll aufgrund von Artikel K.3 des Vertrags über die Europäische Union und von Artikel 41 Absatz 3 des Europol-Übereinkommens über die Vorrechte und Immunitäten für Europol, die Mitglieder der Organe, die stellvertretenden Direktoren und die Bediensteten von Europol
5911European ConferenceEuropa-Konferenz
5912Accession Agreement of the Kingdom of Denmark to the Convention implementing the Schengen Agreement of 14 June 1985 on the gradual abolition of controls at their common borders, signed at Schengen on 19 June 1990Übereinkommen über den Beitritt des Königreichs Dänemark zu dem am 19. Juni 1990 in Schengen unterzeichneten Übereinkommen zur Durchführung des Übereinkommens von Schengen vom 14. Juni 1985 betreffend den schrittweisen Abbau der Kontrollen an den gemeinsamen Grenzen
5913Agreement on the Accession of the Republic of Finland to the Convention implementing the Schengen Agreement of 14 June 1985 on the gradual abolition of checks at the common borders signed at Schengen on 19 June 1990Übereinkommen über den Beitritt der Republik Finnland zu dem am 19. Juni 1990 in Schengen unterzeichneten Übereinkommen zur Durchführung des Übereinkommens von Schengen vom 14. Juni 1985 betreffend den schrittweisen Abbau der Kontrollen an den gemeinsamen Grenzen
5914Agreement on the Accession of the Kingdom of Sweden to the Convention implementing the Schengen Agreement of 14 June 1985 on the gradual abolition of checks at the common borders signed at Schengen on 19 June 1990Übereinkommen über den Beitritt des Königreichs Schweden zu dem am 19. Juni 1990 in Schengen unterzeichneten Übereinkommen zur Durchführung des Übereinkommens von Schengen vom 14. Juni 1985 betreffend den schrittweisen Abbau der Kontrollen an den gemeinsamen Grenzen
5915Brussels configurationBrüsseler Gruppe
5916internal flight alternativeinländische Fluchtalternative
5917to interceptabfangen
5918complaintAntrag
5919Chernobyl Shelter FundFonds für die Ummantelung des Tschernobyl-Reaktors
5920Aarhus ConventionÜbereinkommen von Aarhus
5921MNCHöhere NATO-Kommandobehörde
5922Agreement between the European Community and the United States of America on customs cooperation and mutual assistance in customs mattersAbkommen zwischen der Europäischen Gemeinschaft und den Vereinigten Staaten von Amerika über Zusammenarbeit und gegenseitige Amtshilfe im Zollbereich
5923procedural documentVerfahrensurkunde
5924Action plan to combat organised crimeAktionsplan zur Bekämpfung der organisierten Kriminalität
5925EJNEJN
5926NWFZNWFZ
5927safe country of originsicherer Herkunftsstaat
5928secure networksicheres Netz
5929PIRAPIRA
5930bona fide applicantBona-fide-Antragsteller
5931EU partnersEU-Delegationen
5932Recommendation of the Council on Combating Bribery in International Business TransactionsEmpfehlung zur Bekämpfung von Bestechung bei internationalen Geschäftsabschlüssen
5933Common Agenda for Counter-Terrorism CooperationGemeinsame Agenda für die Terrorismusbekämpfung
5934Joint follow-up groupGemeinsame Follow-up-Gruppe
5935JHA CounsellorJI-Referent
5936outward extraditionAuslieferung
5937inward extraditionEinlieferung
5938non-coding part of the DNA moleculenichtcodierender Teil des DNS-Moleküls
5939Treaty of AmsterdamAV
5940State of the offenceStaat der Zuwiderhandlung
5941counterfeiting and product piracyNachahmung und Produktpiraterie
5942Convention drawn up on the basis of Article K.3 of the Treaty on European Union on Driving DisqualificationsÜbereinkommen aufgrund von Artikel K.3 des Vertrags über die Europäische Union über den Entzug der Fahrerlaubnis
5943CSNCSN
5944Law on coercive methods of criminal investigationGesetz über die Ermittlungsmethoden im Rahmen von Strafverfahren
5945UNCIVPOLCIVPOL
5946Police Experts Working Party (Euro)Gruppe von EURO-Polizeiexperten
5947White PaperWeißbuch
5948Joint CommissionGemeinsame Kommission
5949the new European security environmentdas neue Sicherheitsumfeld in Europa
5950ACE Mobile Force (Land)ACE Mobile Force (Land)
5951OPCOMOPCOM
5952full commandDienst- und Fachaufsicht
5953federal eagleBundesadler
5954common and comprehensive security model for Europe for the 21st centurygemeinsames und umfassendes Sicherheitsmodell für Europa im 21. Jahrhundert
5955high-tech crimeHigh-Tech-Kriminalität
5956PMSC/AHGPMSC/AHG
5957trusted collaboratorV-Mann
5958video surveillanceVideoüberwachung
5959SGPHochrangige Politisch-Militärische Gruppe für Proliferation
5960DGPDGP
5961Human Rights WatchBeobachtungsstelle für Menschenrechte
5962plastic bindingKunststoffbindung
5963a lasting and inclusive peaceein dauerhafter und umfassender Frieden
5964with the aim of creating in Europe a common space of security and stability, without dividing lines or spheres of influence limiting the sovereignty of any statemit dem Ziel, in Europa einen gemeinsamen Sicherheits- und Stabilitätsraum ohne Trennlinien oder Einflusssphären zu schaffen, die die Souveränität irgendeines Staates einschränken
5965the role of the OSCE as the inclusive and comprehensive organisation for consultation, decision-making and cooperation in its areadie Rolle des OSZE als der alle einschliessenden und umfassenden Organisation für Konsultationen, Entscheidungsprozesse und Zusammenarbeit in ihrem Raum
5966trafficking in minorsHandel mit Minderjährigen
5967concurrence of jurisdictionsZuständigkeitskonkurrenz
5968religious nameOrdensname
5969country of concernBesorgnis erregender Staat
5970compulsory repatriationZwangsrepatriierung
5971PPEWUPolitischer Stab
5972RECAMPProgramm zur Stärkung der afrikanischen Friedenssicherungskapazitäten
5973accession partnershipBeitrittspartnerschaft
5974enhanced pre-accession strategyintensivierte Heranführungsstrategie
5975film masterDruckvorlage
5976the EDF’s accountantRechnungsführer des EEF
5977to participate fully and on an equal footingin vollem Umfang und gleichberechtigt teilnehmen
5978chain of custodyBeweiskette
5979programme of exchanges, training and cooperation for persons responsible for action to combat organised crime (FALCONE programme)Austausch-, Ausbildungs- und Kooperationsprogramm für Personen, die für die Bekämpfung der organisierten Kriminalität zuständig sind (FALCONE)
5980to whom it may concernBescheinigung
5981rapid assessment capabilityInstrument zur raschen Bewertung
5982European Civil CodeEuropäisches Zivilgesetzbuch
5983Working Party on the Eastern AdriaticGruppe “Ostadria”
5984extraordinary Council meetingaußerordentliche Tagung des Rates
5985fault-based liabilityVerschuldenshaftung
5986ETFETF
5987criminal penaltyStrafe
5988Schengen Consultation NetworkSchengener Konsultationsnetz
5989Regional Approach Working Party on Former Yugoslavia/AlbaniaGruppe “Regionaler Ansatz: Ehemaliges Jugoslawien/Albanien”
5990central groupZentrale Gruppe
5991revised provisional agendageänderte vorläufige Tagesordnung
5992Convention on rules for the admission of third-country nationals to the Member States of the European UnionÜbereinkommen zur Regelung der Zulassung von Staatsangehörigen dritter Länder in das Hoheitsgebiet der Mitgliedstaaten
5993electronic surveillanceelektronische Überwachung
5994Appeals CommitteeBeschwerdeausschuss
59954-wire formatVierdrahtformat
5996hackingComputerhacking
5997cybercaféCybercafé
5998international handover interfaceinternationale Handover-Schnittstelle
5999argued policy options paperausführlich begründetes Dokument über politische Optionen

 

SIGN IN

Forgot Password

X