load-page

Terminology English – German 2406 monetary relations

Home/Chưa được phân loại/Terminology English – German 2406 monetary relations
Terminology English - German 2836 social protection

Inter Active Terminology of Europe

Terms English – German 2406 monetary relations

Domain: 24 FINANCE

Subdomain: 2406 monetary relations

 

 

No

English US

German DE

1banknote paperPapier
2materialMaterial
3changeover periodÜbergangsperiode
4denominatedlautend
5LSLager
6European sideeuropäische Seite
7sub-frontloadingSub-Frontloading
8outer partaußen
9inner partinnen
10designGestaltung
11instrument of paymentZahlungsdokument
12foreign reserve assetsWährungsreserven
13fixed-rate instrumentfestverzinslicher Schuldtitel
14earmarking systemKennzeichnungsverfahren
15collateral pooling systemPfandpoolverfahren
16BOPSZahlungsbilanz-Statistik
17EMI Annual ReportJahresbericht EWI
18economy of scaleGrößenkostenersparnis
19euro-currencyEuro-Währung
20(dollar bloc)Dollar-Raum
21legal tenderschuldbefreiende Wirkung
22CIRRCIRR
23DDRDAS
24monetary coefficientWährungskoeffizient
25switch-over systemswitch-over-System
26artificial MCAskünstliche WAB
27natural MCAsnatürliche WAB
28real monetary gaprealer Währungsabstand
29ACABeitrittsausgleichsbetrag
30Articles of Agreement of the International Monetary FundAbkommen über den Internationalen Währungsfonds
31assets created as a counterpart to the deposit with the EMCF of gold and dollarsGuthaben entstehen gegen Einzahlung beim EFWZ von Gold und Dollar
32working balancesBetriebsguthaben
33basic balance of paymentsGrundzahlungsbilanz
34exchange brokerBörsenmakler
35debit balanceSchuldsaldo
36deflationDeflation
37currency depreciationAbwertung der Währung
38Managing Director of the IMFgeschäftsführender Direktor des IWF
39exchange rate policyWechselkurspolitik
40ex-post analysisEx-post-Analyse
41extension of medium term creditAusweitung mittelfristiger Kredite
42franc for trade operationsHandels-Franc
43gold assetsGoldbestand, Goldreserve
44gold standardGoldstandard
45to establish a grid of bilateral exchange ratesein Gitter von bilateralen Wechselkursen festlegen
46gross dollar assetsBruttodollarreserven
47holdingsGeldbestände
48hot moneyvagabundierendes Kapital
49compulsory intervention ratesPflichtinterventionskurs
50bank lendingAusleihungen der Banken
51settlement of liabilitiesAusgleich von Schulden
52lombard rateLombardsatz
53matching assets ruleKongruenzregel
54parity ratesParitätsverhältnisse
55flexible exchange rateflexibler Wechselkurs
56floating rates systemSystem floatender Wechselkurse
57floating-rate loanAnleihe mit variablem Zinssatz
58ECU created against reserve assetsgegen Hinterlegung von Reserveinstrumenten geschaffene ECU
59specified revolving swap arrangementsspezifische Swap-Revolving-Abkommen
60market-control priceRichtpreis
61Board of Governors of the European Monetary Cooperation FundVerwaltungsrat des Europäischen Fonds für währungspolitische Zusammenarbeit
62central amountLeitbetrag
63carousel fraudKarussellbetrug
64IMF Structural Adjustment FacilitySAF
65carenciaKarenzfrist
66Paris ClubPariser Club
67ICIWF-Interimsausschuss
68Development CommitteeEntwicklungsausschuss der Weltbank und des FMI
69$$
70budget overrunAusbrechen aus dem festgelegten Haushaltsrahmen
71to activate drawing rightsZiehungsrechte aktivieren
72Community assetgemeinschaftliches Aktivum
73reserve assetsReserveaktivum
74total and irreversible convertibility, at irrevocable paritiesuneingeschränkte, irreversible …
75deposit of reserve assetsHinterlegung von Reserven
76devaluationAbwertung
77diameterDurchmesser
78drawing rightZiehungsrecht
79maximum spread of divergence for each currencymaximale Abweichungsspanne
80continuing issueDaueremission von Schuldverschreibungen
81cashBargeld
82correcting factorBerichtigungsfaktor
83trust fundTreuhandfonds
84monetary gapWährungsabstand
85semi-public financial institutionhalbstaatliches Kreditinstitut
86freely convertible currencyfrei austauschbare Währung
87mobilisation of the claimMobilisierung der Forderung
88means of settlementSaldenausgleich
89reconstitution obligationRekonstitutionsverpflichtung
90outright transactionOutright-Geschäft
91basket systemKorbsystem
92global loanGlobaldarlehen
93presumption to actErwartung des Handelns
94creditor central bankkreditgebende Notenbank
95Treasury billSchatzanweisung
96Monetary CommitteeWährungsausschuss
97Executive Board of the IMFExekutivdirektorium des IWF
98quality standardGütenorm
99ESAFESAF
100EFFerweiterte Fondsfazilität
101CCFFCCFF
102GABAKV
103EMAEWA
104market makerMarktmacher
105CFFCFF
106MTFAMFB
107terms of tradeAustauschverhältnis im Aussenhandel
108denominationNennwert
109ISINISIN
110maximum spot marginmaximale Bandbreite
111exchange arrangementsBestimmungen über den Zahlungsverkehr
112crawling pegflexible Wechselkurse
113economic agentMarktteilnehmer
114inflationary gapinflatorische Lücke
115DCEinländische Kreditausweitung
116ECUECU
117currency basketKorbwährung
118recycling of capitalRecycling
119exchange rateUmrechnungskurs
120central rateLeitkurs
121IMFIWF
122EMCFEFWZ
123TTERDTC
124SDRSZR
125exchange riskFremdwährungsrisiko
126base rateBasiszinssatz (beim CIRR)
127G-24G 24
128ERMWechselkursmechanismus
129NCINGI
130CAAusgleichsabgabe
131MCAWAB
132creditor rallongeGläubigerrallonge
133general payments system of the Member Statesalgemeiner Zahlungsverkehr der Mitgliedstaaten
134official gross reservesamtliche Bruttoreserven
135WAMUWAMU
136STMSKWB
137stability in exchange rate relationshipsWechselkursstabilität
138nominal market ratenominaler Marktkurs
139standby creditBeistandskredit
140near-moneyGeldsubstitute
141exchange rate volatilityWechselkursschwankungen (Pl.)
142a further elaboration and concretisation of the present Reportnähere und konkretere Ausführungen zu diesem Bericht
143the constellation of financial and banking centres in Europedie Lage der europäischen Finanz- und Bankzentre
144committee for monetary policy analysisUnterausschuss für geldpolitische Analyse
145an additional intervention windowein zusätzliches Interventionsfenster
146a Monetary Policy Departmenteine Abteilung für Geldpolitik
147a Foreign Exchange and Reserve Management Departmenteine Abteilung für Devisen- und Reservenpolitik
148the Monetary Policy Committeeder Ausschuss für Geldpolitik
149the Committee on Banking Supervision Policyder Ausschuss für Bankenaufsicht
150the Foreign Exchange Policy Committeeder Ausschuss für Devisenpolitik
151Executive Committeegeschäftsführender Vorstand
152a Board of Directorsein Direktorium
153training groundeine Art Übungsfeld
154the creation of a European Reserve FundEuropäischer Reservefonds
155common surveillance indicatorsgemeinsame Überwachungsindikatoren
156the gradual crowding-out of national currencies by the ecudie ECU würde die nationalen Währungen allmählich verdrängen
157discrete but evolutionary stepsBehutsame, doch evolutionäre Schritte
158their executive and policing functionsDurchführungs- und Kontrollaufgaben
159the Chairman of the ESCBder Präsident des EZBS
160establishment of a BoardEinsetzung eines Direktoriums
161establishment of an ESCB CouncilEinsetzung eines EZBS-Rates
162open market operation in government securitiesOffenmarktgeschäft mit Staatspapieren
163wage formationLohnbildung
164national currencies would become increasingly close substitutes… würden die nationalen Währungen zu immer engeren Substituten
165an overall policy stanceein gesamtpolitischer Kurs
166macroeconomic managementdie makroökonomische Steuerung
167concrete stages leading towards the progressive realisation of economic and monetary unionkonkrete Stufen zur schrittweisen Verwirklichung einer Wirtschafts- und Währungsunion
168to enhance the Community’s monetary capacitydie währungspolitischen Befugnisse der Gemeinschaft … vergrössern
169the ecu’s appeal as a near money substitutedie ECU als nahes Substitut (…) (nur wenig) attraktiv ist
170ecu-denominated depositdie auf ECU lautenden Einlagen
171ECU clearing systemEcu-Verrechnungssystem
172a means of portfolio diversificationMittel zur Portfolio-Diversifizierung
173foreign exchange policy subcommitteeUnterausschuss für Devisenpolitik
174monetary policy subcommitteeUnterauschuss für Geldpolitik
175regulatory powersregulative Befugnisse
176use of the ecu to denominate operations in the intervention and credit mechanismsVerwendung der ECU als Rechengrösse für Operationen im Interventions- und Kreditmechanismus
177use of the ecu as denominator of the exchange-rate mechanismVerwendung der ECU als Bezugsgrösse für den Wechselkursmechanismus
178the autonomous (wage) negotiating processdie Tarifautonomie
179market-oriented economic principlesmarktwirtschaftliche Prinzipien
180elimination of margins of fluctuationBeseitigung der Bandbreiten
181EUAERE
182African Development Fund Unit of AccountFUA
183EMUAEWRE
184EMUWWU
185DERTageskurs
186conditionalityAuflagengebundenheit
187reference zoneReferenzzone
188the most extensive legal capacity accorded to legal persons (under its law)weitestgehende Rechts- und Geschäftsfähigkeit, die juristischen Personen nach den Rechtsvorschriften zuerkannt ist
189monetary capacitywährungspolitische Befugnisse
190consistencyKohärenz
191consolidated balance sheetkonsolidierte Bilanz
192class of sharesAktiengattung
193revaluationAufwertung
194dismantlement (monetary compensatory amounts)Abbau der Währungsausgleichbeträge
195interbank rateInterbankrate
196foreign currencyFremdwährung
197investment in fixed capitalAnlageinvestition
198mechanism for short-term monetary supportSystem des kurzfristigen Währungsbeistands
199creditor quotaGläubigerquote
200additional reservefreie Rücklage
201Alternate Members of the Monetary CommitteeStellvertreter des Währungsausschusses
202cost-push inflationKostendruckinflation
203seigniorageMünzgewinn
204EurofedEurofed
205Plaza accordPlaza-Abkommen
206CLIOCLIO
207the ecu (plural : the ecus)die ECU
208debt management policyöffentliche Schuldenpolitik
209covered by non-monetary meansüber den Kapitalmarkt finanziert
210to mop up excess liquidityüberschüssige Liquidität abschöpfen
211standby arrangementBereitschaftskreditabkommen
212absorption of central bank balancesAbsorption von Zentralbankguthaben
213degree of divergenceAbweichungen
214agri-monetary regulationsagromonetäre Verordnungen
215savings in equitiesAktiensparen
216official settlementsamtliche Transaktionen, offizielle Reservetransaktionen
217securities dealt in on a stock exchangean Börsen gehandelte Wertpapiere (1)
218supply-side measuresangebotsorientierte Massnahmen
219rate of fixed investmentAnlageinvestitionsquote
220external foreign currency positionsauf Fremdwährungen lautende Auslandspositionen
221guilder notesauf Gulden lautende Euro-Darlehen
222SDR-denominated liabilitiesauf SZR lautende Verbindlichkeiten
223emergence of exogenous disturbancesAuftreten exogener Störungen
224revaluationAufwertung
225central government expenditureAusgaben des Zentralstaates
226settlement of the positionsAusgleich der Salden
227compensatory operations to control liquidityausgleichende Liquiditätssteuerung
228means of settlementAusgleichsmedium
229payable to/receivable from Member States for adjustment of capitalAusgleichverbindlichkeiten gegenüber/Ausgleichsforderungen an Mitgliedstaaten
230external indebtednessAuslandsverschuldung
231external balanceAußenbeitrag
232external capital flowsaussenwirtschaftliche/aussenwirtschaftlich bedingte Kapitalbewegungen
233external deficitZahlungsbilanzdefizit
234balance of payments imbalancesaussenwirtschaftliches Ungleichgewicht
235exceptional disturbancesaussergewöhnliche Störungen
236money market instrumentGeldmarktinstrument
237unpaid capitalausstehende Einlagen auf das Grundkapital
238expansion of creditAusweitung des Kreditvolumens
239automatic renewalautomatische Verlängerung
240bank liquidityBankenliquidität
241currency in circulationBargeld im Umlauf
242liquidityLiquidierbarkeit
243cash reservesBarreserven
244limited split of the foreign exchange marketsbegrenzte Spaltung des Devisenmarktes
245calculation of the ceilingBerechnung der Plafonds
246reference rateBezugssatz
247bilateral limitbilateraler Interventionspunkt
248accounting relationshipsbuchungstechnische Beziehungen, Bilanzzusammenhang
249meeting of any shortfallDeckung von Verlusten
250demand pull inflationNachfrageinflation
251the dollar as a vehicle and reserve currencyder Dollar als Transaktionswährung
252destabilising effectdestabilisierendee Einfluss
253foreign currenciesDevisen
254foreign exchangeDevisen
255foreign exchange outflowsDevisenabflüsse
256currency arbitrageDevisenarbitrage
257foreign currency offset agreements with the U.S.Devisenausgleichsabkommen mit den USA
258foreign exchange earningsDeviseneinnahmen
259advances in foreign currencyDevisenkredite
260exchange marketDevisenmarkt
261exchange restrictionsZahlungsbeschränkungen (2)
262exchange reservesDevisenreserven
263FX swapDevisenswap
264inflow of foreign exchangeDevisenzufluss, Devisenzugang
265the effects of the increase may be neutraliseddie Anhebung kann in ihrer Zielsetzung unterlaufen werden
266the DM’s role as an alternative reserve currencydie DM als alternative Reservewährung
267discount marketDiskontmarkt
268DIAbweichungsindikator
269divergence thresholdAbweichungsschwelle
270threshold of divergence/divergence thresholdAbweichungsschwelle
271triangular financing operations/schemesDreiecksfinanzierung
272third currenciesDrittländerwährungen (2)
273ECU basket (formula)ECU-Korbformel
274to reduce exchange rate fluctuationsEindämmung der Wechselkursschwankungen
275to discontinue the listing of the securityEinstellung der amtlichen Notierung eines Wertpapieres
276expected rate of inflationerwartete Inflationsrate
277fine tuningFeinabstimmung
278fixed exchange rate relationshipsfester Wechselkursverbund
279monetary targetingFestlegung von Geldmengenzielen
280financial variablesfinanzielle Variablen
281general government net borrowingFinanzierungsdefizit des Gesamtstaates
282financial intermediariesFinanzinstitute
283free liquid reservesfreie Liquiditätsreserven
284flexible exchange ratesflexible Wechselkurse
285floating exchange rateflexibler Wechselkurs
286foreign currency liabilitiesFremdwährungsverbindlichkeiten
287functional relationshipsfunktionelle Beziehungen
288non-residentDevisenausländer
289financial assetsFinanzaktiva
290demand for moneyGeldbedarf
291interest rate on money marketGeldmarktsatz
292monetary expansionGeldmengenexpansion (1)
293monetary supply growthGeldmengenwachstum
294personal sector’s liquid assetsgeldnahe Aktiva der Haushalte
295monetary normsgeldpolitische Normen (1)
296flow of fundsGeldströme
297secondary liquidityGeld- und Quasigeldmenge
298monetary growthGeldmengenwachstum
299primary liquidityGeld- und Quasigeldvolumen
300money and quasi-moneyGeldvolumen und Quasigeldbestände
301Community exchange rate systemgemeinschaftliches Wechselkurssystem
302dual exchange marketgespaltener Devisenmarkt
303vending machineGetränkeautomat
304weight in the ECU basketGewichtungskoeffizient im ECU-Korb
305creditor countryGläubigerland
306gold transactionsGoldgeschäfte
307degree of “moneyness”Grad an Geldqualität
308block floatBlockfloating, gemeinsames Floaten
309claims on the central bankGuthaben bei der Zentralbank
310tightening of monetary policyHärtung der Geldpolitik/des geldpolitischen Kurses
311appreciation of a currencyAufwertung
312commercial banksHandelsbanken
313erratic movementserratische Kursausschläge
314under repurchase agreements (swaps)im Rahmen von Swap-Vereinbarungen
315drawing on the credit facilitiesInanspruchnahme der Kreditfazilitäten
316currency in oppositionin der Gegenposition stehende Währung
317indexation mechanismIndexierungsmechanismus
318induced changesinduzierte Veränderungen
319inflation rateInflationsrate
320bout of inflationInflationsanstoss
321inflationary overheatinginflatorische Überhitzung
322residentEinwohner
323domestic expenditureinländische Ausgaben
324total domestic creditgesamte(r) inländische(r) Kredit/Kreditgewährung
325denominated in national or in foreign currenciesauf Landes- oder Fremdwährung lautend (2)
326domestic creditInlandskredite
327domestic and foreign liabilitiesInlands- und Auslandsverbindlichkeiten
328overall economic management/management of the economyInstrumente der Globalsteuerung
329means of offsetting the social consequencesInstrument zum Ausgleich der sozialen Folgen
330international bond marketsinternationale Rentenmärkte
331domestic liquidityInlandsliquidität
332intervention on the foreign exchange marketIntervention am Devisenmarkt
333intervention currencyInterventionswährung
334CAPEXInvestitionsaufwendungen
335G 24Gruppe der 24 Industrieländer
336restrictions on outflows of capitalKapitalexportbeschränkungen
337lenders and borrowersKapitalgeber und Kapitalnehmer
338capital-deepening investmentVerbesserungsinvestition
339capital market borrowingKapitalmarktmittel
340capital market rateKapitalmarktzinssatz
341personal capital movementsKapitalverkehr mit persönlichem Charakter
342exchange risk coverDeckung des Wechselkursrisikos
343cyclical fluctuationsKonjunkturschwankungen
344contrasting colourKontrastfarbe
345global credit approachKonzept der gesamten Kreditgewährung
346overdraft systemKreditüberziehungssystem
347credit facilitiesKreditmöglichkeiten
348ceilings for creditsBereitstellungsplafonds
349monetary controlGeldmengensteuerung
350monetary policy meansgeld- und kreditpolitische Massnahmen
351credit rationingKreditrationierung
352credit targetsKreditziele
353day to day monetary managementkurzfristige Geldpolitik
354short-term liquid assetskurzfristige liquide Anlagen
355short-term liabilitieskurzfristige Verbindlichkeiten
356short-term interest rateskurzfristiger Zins
357daily rate for conversionTagesumrechnungskurs
358realignmentAnpassung der Leitkurse
359base ratesLeitzinsen
360liquid savingsliquide Ersparnisse
361base assetsliquide Mittel
362monetary and other financial assetsliquide Mittel und nicht im Geldvolumen erfasste finanzielle Aktiva
363liquidity of the economyLiquidität der Wirtschaft
364excess liquidityLiquiditätsüberhänge
365loss of liquidityLiquiditätsentzug (1)
366liquidity ratio of the economyLiquiditätsrate der Wirtschaft
367local authoritylokale Gebietskörperschaften
368marketable securitiesmarktgängige Titel
369market forcesMarktkräfte
370official stock exchange marketMarkt mit amtlicher Notierung
371anti-inflationary measuresMassnahmen zur Inflationsbekämpfung
372exchange differencesWechselkursdifferenzen
373minimum reserve requirementsMindestreservepflicht
374to release fundsMittel freigeben
375monetary financingFinanzierung der Geldschöpfung
376monetary indicatormonetärer Indikator
377monetary resourcesmonetäre Ressourcen
378monetary restrictionsgeld- und kreditpolitische Restriktionen (2)
379techniques of monetary controlgeldpolitisches Instrumentarium
380monetary objectiveGeldmengenziel
381monetary cooperationmonetäre Zusammenarbeit
382lead accountingnachperiodische Berechnungsweise
383close to unitynahezu eins
384negative interest rateNegativzinsen (pl.)
385net financial positionNettofinanzierungsposition
386non-banksNichtbanken
387non-bank sectorNichtbanken
388non-bank private sectorsNichtbanken des privaten Sektors
389non-monetary factorsnicht-monetäre Faktoren
390non-monetary meansgeldmengenneutrale Mittel (2)
391non-monetary savings medianichtmonetäre Sparmedien
392unpredictable swings in cash flowsnichtvorausbestimmbare Schwankungen in den Zahlungsströmen
393offshore branchesNiederlassungen ausserhalb Grossbritanniens
394nominal interest rateNominalzins
395numeraireNumeraire
396unused credit linesoffene Kreditzusagen
397to re-establish par valuesParitäten neu festsetzen
398quantitative monetary policy objectivesquantitative geldpolitische Ziele
399quasi-capitalQuasi-Kapital
400repurchase of securitiesRückkauf von Wertpapieren
401real sectorrealer Sektor
402EMS realignmentAnpassung im EWS
403range of monetary indicatorsReihe monetärer Indikatoren
404yield differentialRenditenabstand
405eligible liabilitiesberücksichtigungsfähige Verbindlichkeiten
406IMF reserve positionIWF-Reserveposition
407reserve ratioMindestreservesatz
408austerity policyAusteritätspolitik
409roundingRunden der Zahlen
410rounding-off differenceRundungsdifferenz
411creation of monetary baseSchöpfung von Zentralbankgeld
412treasury paperSchatzwechsel
413debt servicingSchuldendienst
414debtor countrySchuldnerland
415debt certificateSchuldverschreibung
416floating rate notesSchuldverschreibungen mit variablen Zinssätzen
417margin of fluctuation for the currenciesBandbreite der Währungen (2)
418variability of exchange ratesSchwankungsbreite der Wechselkursbewegungen
419fluctuation reserveSchwankungsreserve
420self-financingSelbstfinanzierung
421significant figuressignifikante Zahlen
422special reservesSonderrücklage
423public budgetStaatshaushalt
424stagflationStagflation
425fall in the exchange rateKursverlust einer Währung
426statistical seriesstatistische Reihen
427fiscal dragSteuerdrift
428penalty rateStrafsatz
429substitution accountSubstitutionskonto
430supplementary special deposit scheme or “corset”supplementary special deposit scheme, das sog. Korsett
431dual-guarantee systemSystem der doppelten Garantie
432mechanism for very short-term financingSystem der sehr kurzfristigen Finanzierung
433system of so-called target zones expressed in effective exchange ratesSystem so genannter Zielzonen in Form effektiver Wechselkurse
434participating currencyTeilnehmerwährung
435overshootingTendenz zur “Überanpassung” der Wechselkurse
436mandatory reserve requirementMindestreservesatz
437portfolio investmentPortfolioinvestition
438preferential ratePräferenzbeteiligungssatz
439primary liquidityPrimärliquidität
440loss of outputProduktionseinbussen
441repaymentRückzahlung
442bracketMarge
443reversal in the debtor country’s positionUmkehr der Schuldnerposition eines Landes
444velocity of circulationUmlaufgeschwindigkeit
445rescheduling of the external debtUmschuldung von Auslandsschulden
446depreciation below the target zoneUnterschreitung der Zielzone
447variability of interest ratesveränderliche Zinssätze
448closed bond (or “0” guilder circuit)O-Guldenkreislauf
449crowding-out effectVerdrängungseffekt
450renewal by mutual agreementVerlängerung im gegenseitigen Einvernehmen
451narrowing of the margins of fluctuationVerringerung der Bandbreiten
452switchVerschiebungen (pl.)
453external indebtednessAuslandsverschuldung (3)
454ECU as a denominator for loans floated by the Community institutionsECU als Numeraire für Anleihen der Europäischen Institutionen
455lagged accountingvorperiodische Berechnungsweise
456advance redemptionvorzeitige Ablösung
457monetary authoritiesWährungsbehörden
458denominationWährungseinheit
459monetary goldWährungsgold
460monetary policyGeld- und Währungspolitik
461monetary disturbancesWährungsunruhen
462exchange rate agreementWährungsverbund
463adjustment of central ratesAnpassung der Wechselkurse
464exchange rate relationsWechselkursbeziehungen
465exchange guaranteeWechselkursgarantie
466exchange parityWechselkursparität
467exchange rate fluctuationWechselkursschwankungen
468re-lending of fundsWeitergabe von Mitteln
469economic fundamentalsgesamtwirtschaftliche Eckdaten
470money supplyWirtschaftsliquidität, Liquidität der Wirtschaft
471housebuildingWohnbau
472housing financeWohnungsbaufinanzierung
473subscription applicationZeichnungsantrag
474high-powered moneyGeldbasis
475central bank moneyNotenbankgeld
476central numérairezentraler Wertmassstab
477target variableZielgrösse
478monetary growth target rangeZielmarge für die Geldmengenexpansion
479target rangeZielkorridor
480interest arbitrage transactionsZinsarbitrage
481interest shortfallZinsfehlbetrag
482interest rate differentialZinsabstand
483economic and monetary policyWirtschafts- und Währungspolitik
484investorsAnlegerpublikum, Anlegerkreise (pl.)
485Working Party on Short-Term Capital MovementsArbeitsgruppe (des Währungsausschusses) “Kurzfristige Kapitalbewegungen”
486upward pressureAufwärtsdruck
487market interest rateMarktzins
488outstanding amountsBestand
489discount houseDiskonthaus
490disinflationDesinflation
491exchange restrictions on the movement of capitaldevisenrechtliche Beschränkungen des Kapitalverkehrs
492consortium operationKonsortialfinanzierung
493Euro-loanEurokredite (pl.)
494galloping inflationgaloppierende Inflation
495countermeasureGegenmassnahmen (pl.)
496monetary/money creation (by the banks)Geldschöpfung
497domestic creditInlandskredit
498global creditGlobalkredit
499weights of currenciesGewichte der Währungen
500scriptural moneyBuchgeld (2)
501trade creditHandelskredit
502international reserve assetinternationale Reservemedien (pl.) (1)
503cross-conditionalityKreuzkonditionalität
504NCLandeswährung
505compulsory reservesMindestreserven
506minimum reservesMindestreserven
507reserve requirementMindestreservepflicht
508creditMittel, Haushaltsmittel, Mittelansätze, Ausgabenansätze, Kredit, Kredite
509monetary controlkreditpolitische Kontrolle
510monetary restrictionmonetäre Restriktion
511multiple rates of exchange/exchange ratesmultiple Wechselkurse
512net external positionNettoauslandsposition
513real rate of interest/interest rateEffektivverzinsung
514reserve assets ratioRAR
515revolving characterrevolvierender Charakter
516creeping inflationschleichende Inflation
517fluctuation bandBandbreite
518Swiss francSchweizer Franken
519SDR basketSRZ-Korb
520support purchasesStützungskäufe
521Exchequer foreign borrowingstaatliche Kreditaufnahme im Ausland
522sharp squeezestarke Verknappung
523deferment of amortisationTilgungsaufschub
524conversion algorithmUmrechnungsregel
525settlement systemVerrechnungssystem
526capital flightEinlagenflucht
527central bank money stock (CBM)Zentralbankgeldmenge
528long-term interest rateKapitalmarktsätze (4)
529corsetzusätzliche Sondereinlagen
530committee of Twenty (committee for the Reform of the International Monetary System and associated questions)Zwanziger-Ausschuss
531parity gridParitätengitter
532unused refinancing facilitiesunausgenutzte Refinanzierungslinien
533MCAWAB
534new monetary institutionneue monetäre Institution
535single currencyeinheitliche Währung
536Group of Personal RepresentativesGruppe der persönlichen Beauftragten
537its objectives of internal and external monetary stabilityseine Ziele der inneren und äusseren Währungsstabilität
538the exchange rate constraintdie vom Wechselkursmechanismus ausgehenden Zwänge
539the ECU serves primarily as a reserve asset and a means of settlement for EMS central banksdie ECU dient hauptsächlich als Reservemedium und Instrument für den Saldenausgleich zwischen den Zentralbanken des EWS
540a broadly balanced developmenteine im ganzen ausgewogene Entwicklung
541budgetary positionsdie Positionen der öffentlichen Haushalte
542mutually consistent macro-economic policieseine wechselseitig konsistente makroökonomische Politik
543a more balanced economic structure throughout the Communityeine ausgewogenere Wirtschaftsstruktur in der gesamten Gemeinschaft
544unsustainable differences between individual member countriesuntragbare Unterschiede zwischen den einzelnen Mitgliedsländern
545the creation of a single currency areadie Schaffung eines einheitlichen Währungsraums
546remove intra-Community exchange rate uncertainties (… and) eliminate exchange rate variabilitydie Unsicherheit über die innergemeinschaftlichen Wechselkurse beseitigen (… und) die Variabilität der Wechselkurse ausschalten
547to enhance the process of resource allocation in those economic sectors and geographical areas where the working of market forces needed to be reinforced or complementedzur Verbesserung der Ressourcenallokation in solchen Branchen und Regionen, in denen die Marktkräfte verstärkt oder ergänzt werden müssen
548hard ecuharter Ecu
549overdraft or any other type of credit facilityÜberziehungs- oder Kreditfazilität
550penalty interestStrafzinsen
551foreign-exchange assetsDevisen
552Rules governing the size and the financing of national budget deficitsRegeln über den Umfang und die Finanzierung nationaler Haushaltsdefizite
553to facilitate the financing of economic imbalancesdie Finanzierung wirtschaftlicher Ungleichgewichte erleichtern
554a common overall assessment of the short-term and medium-term economic developments in the Communityeine gemeinsame Gesamtbeurteilung der kurz- und mittelfristigen wirtschaftlichen Entwicklung der Gemeinschaft
555to exclude access to direct central bank credit and other forms of monetary financingden Zugang zu Zentralbankkrediten und anderen Formen monetärer Finanzierung ausschliessen
556appropriate delegation of authorityangemessene Kompetenzübertragung
557formulating and implementing monetary policy as well as managing the Community’s exchange rate policy vis-à-vis third currenciesdie Erarbeitung und Umsetzung der Geldpolitik und die Handhabung der Wechselkurspolitik der Gemeinschaft gegenüber Drittwährungen
558exchange rate and reserve managementdie Wechselkurssteuerung und die Verwaltung der Währungsreserven
559the provision not to lend to public-sector authoritiesdie Vorschrift, keine Kredite an öffentliche Stellen zu gewähren
560a supervisory council or a committee of independent auditorsein Aufsichtsrat oder ein Ausschuss unabhängiger Rechnungsprüfer
561exchange controlDevisenkontrolle, Devisenbewirtschaftung
562exchange authorisationdevisenrechtliche Genehmigung
563pre-emptionBezugsrecht
564non-inflationary economic growthinflationsfreies Wirtschaftswachstum
565economic governmentWirtschaftsregierung
566abnormal capital movementsanomale Geldbewegungen
567supervisory authoritiesAufsichtsbehörden
568weighted votingAbstimmung mit Stimmgewichtung
569VSTFsehr kurzfristige Finanzierung
570irrevocably fixed exchange ratesunwiderruflich festgelegte Wechselkurse
571external borrowingKreditaufnahme im Ausland
572other holdersonstiger Halter
573ratio of planned or actual government deficit to gross domestic productVerhältnis des voraussichtlichen oder tatsächlichen öffentlichen Defizits zum Bruttoinlandsprodukt
574holding and management of the official foreign reservesHaltung und Verwaltung der offiziellen Währungsreserven
575freedom of paymentsFreiheit des Zahlungsverkehrs
576EMIEWI
577key interest rateLeitzinssatz
578excessive government deficitübermässiges öffentliches Defizit
579monetary incomemonetäre Einkunfte
580special lending arrangementsbesondere Kreditabkommen
581the currency composition of the ECU basketZusammensetzung des ECU-Währungskorbs
582BEFbelgischer Franc
583Rules governing the Monetary CommitteeSatzung des Währungsausschusses
584assets held against notes in circulationVermögenswerte als Gegenposten zum Bargeldumlauf
585General CouncilErweiterter Rat der EZB
586stock of government debtHöhe des öffentlichen Schuldenstands
587maximum permissible ratios between those reserves and their basishöchstzulässige Relationen zwischen diesen Mindestreserven und ihrer Basis
588allocation of net profits and losses of the ECBVerteilung de Nettogewinne un Verluste der EZB
589clearing and payment systemsVerrechnungs- und Zahlungssysteme
590current exchange ratesjeweiliger Wechselkurs
591foreign-exchange working balancesArbeitsguthaben in Fremdwährungen
592reporting requirementsBerichtspflichten
593intermediate monetary objectivegeldpolitische Zwischenziele
594supply of reservesBereitstellung von Zentralbankgeld
595bilateral central ratebilateraler Leitkurs
596average nominal long-term interest ratedurchschnittlicher langfristiger Nominalzinssatz
597Protocol on DenmarkProtokoll betreffend Dänemark
598Protocol on PortugalProtokoll betreffend Portugal
599Protocol on the transition to the third stage of economic and monetary unionProtokoll über den Übergang zur dritten Stufe der Wirtschafts- und Währungsunion
600Protocol on certain provisions relating to DenmarkProtokoll über einige Bestimmungen betreffend Dänemark
601Protocol on FranceProtokoll betreffend Frankreich
602Chairman (Monetary Committee)Präsident (Währungsausschuss)
603initial marginSicherheitsmarge
604irrevocable fixing of exchange ratesunwiderrufliche Festlegung der Wechselkurse
605single monetary policy and exchange-rate policyeinheitliche Geld- und Wechselkurspolitik
606sound monetary conditionsgesunde Monetäre Rahmenbedingungen
607official foreign reserves of the Member Statesoffizielle Währungsreserven der Mitgliedstaaten
608denominations and technical specifications of all coins intended for circulationStückelung und technische Merkmale aller für den Umlauf bestimmten Münzen
609issue of banknotesAusgabe von Banknoten
610to impose fines or periodic penalty payments on undertakingsUnternehmen mit Geldbussen oder Zwangsgeldern belegen
611formal agreement on an exchange-rate system for the ECUförmliche Vereinbarung über ein Wechselkurssystem für die ECU
612President of the Executive BoardPräsident des Direktoriums
613person of recognised standing and professional experience in monetary or banking mattersaus dem Kreis der in Währungs- oder Bankfragen anerkannten und erfahrenen Persönlichkeit
614Council of the EMIRat des EWI
615President of the EMIPräsident des EWI
616co-ordination of the monetary policies of the Member StatesKoordinierung der Geldpolitiken der Mitgliedstaaten
617rules and practices governing the collection, compilation and distribution of statisticsBestimmungen und Gepflogenheiten auf dem Gebiet der Erhebung, Zusammenstellung und Weitergabe statistischer Daten
618ECU banknoteEcu-Banknote
619conduct of monetary policyDurchführung der Währungspolitik
620normal fluctuation marginnormale Bandbreite
621long-term interest-rate levelNiveau der langfristigen Zinssätze
622conversion rates at which the currencies shall be irrevocably fixedUmrechnungskurse, auf die die Währungen unwiderruflich festgelegt werden
623to abrogate a derogationeine Ausnahmeregelung aufheben
624reporting commitmentBerichtspflicht
625existing practices regarding the issue and design of banknotesGepflogenheiten bei der Ausgabe und der Gestaltung von Banknoten
626marketable instrumentbörsengängiges Wertpapier
627other instruments of monetary controlsonstige geldpolitische Instrumente
628the national central banks shall be the sole subscribers to and holders of the capital of the ECBdie nationalen Zentralbanken sind alleinige Zeichner und Inhaber der Kapitals der EZB
629transfer of foreign-reserve assets to the ECBÜbertragung von Währungsreserven auf die EZB
630assets earmarkederfasste Vermögenswerte
631the EMI shall be entitled to hold and manage foreign-exchange reserves as an agent for and at the request of national central banksdas EWI ist befugt, auf Ersuchen nationaler Zentralbanken als deren Agent Währungsreserven zu halten und zu verwalten
632claims and liabilities arising from the very short-term financing mechanism and the short-term monetary support mechanismForderungen und Verbindlichkeiten aufgrund des Systems der sehr kurzfristigen Finanzierung und des Systems des kurzfristigen Währungsbeistands
633CFP francCFP-Franc
634Board of GovernorsGouverneursrat des Internationalen Währungsfonds
635African Financial CommunityAfrikanische Finanzgemeinschaft
636agrimonetary arrangementsagromonetäre Regelung
637ECU clearing and settlement systemECU-Verrechnungs- und Saldenausgleichssystem
638DKKdänische Krone
639Deutsche MarkDEM
640commodity derivativesvom Warenhandel abgeleitete Instrumente
641settlement riskAbwicklungsrisiko
642fixed currencyfeste Währung
643floating currencyfloatende Währung
644XEUECU-ISO-Code
645nomenclature of capital movementsNomenklatur für den Kapitalverkehr
646domestic money marketinländischer Geldmarkt
647colouredverfärbt
648EC Mint Directors Working GroupArbeitsgruppe der Direktoren der Münzanstalten der EG
649CFA francCFA-Franc
650ATSösterreichischer Schilling
651cash management systemBargeldverwaltungssystem
652private consumption deflatorPreisdeflator/Deflator des privaten Verbrauchs
653Subcommittee on Monetary AffairsUnterausschuss Währung
654imbalancesUngleichgewichte
655lock-up lendinglangfristiger Kredit
656remote access to an IFTSFernzugang zu einem Interbank-Überweisungssystem
657Basle-Nyborg AgreementBasel-Nyborg-Abkommen
658IFTSInterbank-Überweisungssystem
659fixed rate tenderFestsatztender
660variable rate tenderTender mit variablem Zinssatz
661settlement agentVerrechnungsstelle
662ACRlandwirtschaftlicher Umrechnungskurs
663TARGETTARGET
664French francfranzösischer Franc
665Concertation GroupKonzertationsgruppe
666Monitoring GroupMonitoring-Gruppe
667intervention at the limitsIntervention am Interventionspunkt
668intra-marginal interventionintramarginale Intervention
669large-value paymentsGrossbetragszahlungen
670direct participants (access) in IFTSDirektteilnehmer an Interbank-Überweisungssystemen
671liquidity sharing agreementLiquiditätsaufteilungsregel
672loss sharing rule, loss sharing agreementHaftungsverbund
673Zero-hour clauseNull-Uhr-Klausel
674Green Paper on the practical arrangements for the introduction of the single currencyGrünbuch über die praktischen Fragen des Übergangs zur einheitlichen Währung
675liquidity riskLiquiditätsrisiko
676critical masskritische Masse
677budget deficitDefizit des Staatssektors
678EMSEWS
679reference scenarioReferenzszenario
680cyclically-adjusted deficitkonjunkturbereinigtes Haushaltsdefizit
681CCRzentrales Kreditregister
682DVPL/Z
683NSSNettoausgleichssystem
684RTGSBruttoabwicklungssystem in Echtzeit
685interlinking mechanismInterlinking-Mechanismus
686FTSSystem zum Transfer von Geldbeträgen
687Global Economic OutlookBericht zu den Entwicklungsperspektiven der Weltwirtschaft
688euro areaEuro-Gebiet
689to counteract market pressuresden Marktspannungen begegnen
690Working Group EUROArbeitsgruppe EURO
691special interest-bearing loanverzinsliches Sonderdarlehen
692non-euro-area-currenciesnicht dem Euro-Währungsgebiet angehörende Währungen
693non-euro-area NCBsnationale Zentralbanken der nicht am Euro-Währungsgebiet teilnehmenden Mitgliedstaaten
694remote accessFernzugang
695centCent
696monetary liabilitiesmonetäre Verbindlichkeiten
697euro unitEuro-Einheit
698budgetary convergenceKonvergenz im Bereich der öffentlichen Finanzen
699real exchange rate misalignmentreale Wechselkursverzerrungen
700budgetary positionHaushaltslage
701denomination of a legal instrumentWährungsbezeichnung eines Rechtsinstruments
702excessive nominal exchange rate fluctuationsübermäßige Schwankungen der nominalen Wechselkurse
703nominal exchange rate mechanismein an nominalen Wechselkursen ausgerichtetes System
704non-euro area Member Statenicht dem Euro-Währungsgebiet angehörender Mitgliedstaat
705significant misalignmentspürbare Kursverzerrung
706standard fluctuation bandStandardbandbreite
707standard wide bandweitgefasste Standardbandbreite
708foreign exchange interventionDevisenmarktintervention
709standard wide marginInterventionspunkte der weitgefassten Standardbandbreite
710intervention arrangementsInterventionsregelung
711monetary policy operationsgeld- und währungspolitische Massnahmen
712new tradeable public debtneue handelbare Schuldtitel der öffentlichen Hand
713redenomination of the outstanding debt in the euro unitausstehende Schuldtitel auf die Euro-Einheit umstellen
714CPMIAusschuss für Zahlungs- und Abrechnungssysteme der Zentralbanken der G10
715IIPAuslandsvermögensstatus
716closer linkengere Anbindung
717closer exchange-rate linkengere Wechselkursanbindung
718narrower fluctuation bandschmalere Bandbreite
719exchange-rate arrangementWechselkursanbindung
720interest rate measureZinsmaßnahme
721severe recessionschwere Rezession
722adoption of the euroEinführung des Euro
723continuity of contractsKontinuität von Verträgen
724financial position of general governmentFinanzlage des Staates
725book-entry system(System der) Girosammelverwahrung
726currency boardfeste Anbindung an eine Ankerwährung
727compensating controlsEigenkontrollen
728euroEuro
729sustainability of exchange rate relationsTragfähigkeit der Wechselkursrelationen
730NABNKV
731Debt Initiative for the heavily indebted poor countriesHIPC-Entschuldungsintiative
732deficit reductionDefizitabbau
733rules for roundingRundungsregeln
734arbitrageArbitrage
735allocationAllokation
736prepaid SIM cardGuthabenkarte
737pre-inNichtteilnehmerstaat
738EURIBOREURIBOR
739tolaTola
740RTbefristete Transaktion
741non-transferable assetnicht übertragbarer Vermögenswert
742bilateral procedurebilaterale Geschäfte (pl.)
743international CSDinternationale Wertpapierverwahrstelle
744chainingVerkettung
745final transferendgültige Übertragung
746final settlementendgültige Erfüllung
747legal riskrechtliches Risiko
748end-of-day gross settlement systemTagesschluss-Bruttoabwicklungssystem
749capital riskKapitalverlustrisiko
750clearanceClearing
751guarantee modelGarantiemodell
752DVP linkL/Z-Verbindung
753Master Foreign Exchange Swap AgreementRahmenvereinbarung über Devisenswaps
754nominal effective exchange ratenominaler effektiver Wechselkurs
755one-off measureeinmalige Massnahme
756bilateral exchange ratesbilaterale Wechselkurse
757narrow bandenge Bandbreite
758exchange rate turbulenceWechselkursturbulenz
759accumulated debt stocksaufgelaufene Schulden
760settlement positionAbrechnungsposition
761common eligibility criteriaeinheitliche Zulassungskriterien
762intraday liquidityInnertagesliquidität
763multilateral net positionmultilaterale Nettoposition
764PPP exchange rateKaufkraftparität
765short-term interest rate differentials against Germanykurzfristige Zinsdifferenzen gegenüber Deutschland
766GRDGRD
767ESPESP
768import price inflationAnstieg der Importpreise
769fixed exchange rate systemSystem fester Wechselkurse
770primary gapPrimärlücke
771bilateral divergenceAbweichung von den bilateralen Leitkursen
772private ecuprivate ECU
773substitutes for moneyGeldsubstitute
774interbank liquidityGeldmarktliquidität
775monetary frameworkgeldpolitische Strategie
776Irish poundirisches Pfund
777Italian liraitalienische Lira
778Portuguese escudoportugiesischer Escudo
779Finnish markkaFinnmark
780Swedish kronaschwedische Krone
781overnight market interest rateTagesgeldsatz
782truncatedverkürzt
783non-cash formbargeldlos
784remote participantFernzugangsteilnehmer
785cross-border money transfergrenzüberschreitender Zahlungsverkehr
786retail paymentMassenzahlung
787confirmationBestätigung
788gross settlement systemBruttoabwicklungssystem
789uninvested cash balancenicht angelegte Barguthaben
790transactions balancesTransaktionskasse
791fixed-term advances rateZinssatz für Vorschüsse
792reserve currencyAnlagewährung
793pooling of the currencyVergemeinschaftung der Währung
794deepening of the single marketVertiefung des Binnenmarktes
795sustainable debt trendTragfähigkeit des Schuldentrends
796inflation convergenceKonvergenz der Inflationsraten
797retrenchmentHaushaltseinsparungen (pl.)
798debt service burdenSchuldendienstlast
799SFABestandsanpassung
800fixed interest rate instrumentFestzinsinstrument
801monetary lawWährungsrecht
802national currency unitnationale Währungseinheit
803inverse rate derived from the conversion ratevom Umrechnungskurs abgeleiteter inverser Kurs
804REERrealer effektiver Wechselkurs
805denominations and technical specifications of euro coins intended for circulationStückelungen und technische Merkmale der für den Umlauf bestimmten Euro-Münzen
806issue of euro coinsAusgabe der Euro-Münzen
807Community coinage systemMünzsystem der Gemeinschaft
808to move to a new coinage systemUmstellung auf ein neues Münzsystem
809Spanish flowerSpanische Blume
810cyclically adjustedkonjunkturbereinigt
811Euro GroupEuro-Gruppe
812CACFAZ
813recognised exchangeanerkannte Börse
814EONIAEONIA
815budget deficit ratioDefizitquote
816ERM 2WKM II
817participating Member Statebeteiligter Mitgliedstaat
818DSASchuldentragbarkeitsanalyse
819intervention mechanismInterventionsmechanismus
820medium-term loanmittelfristiger Kredit
821borrowing interest rateHabenzinsen
822pricing structurePreisgefüge
823credit marketKreditmarkt
824net inflows of capitalNettokapitalimport
825liabilities to non-residentsAuslandsverbindlichkeiten
826public paperamtliches Wertzeichen
827stock market yieldBörsenrenditen
828share price indexAktienkursindex, Aktienpreisindex
829issue for general subscriptionöffentliches Angebot
830structural indicatorStrukturindikator
831PINPIN
832CCLCCL
833suspect moneyRegistriergeld
834central government expenditureStaatsausgaben
835introduction of the euroBeginn des Bargeldumlaufs des Euro
836loro accountLorokonto
837deficit-debt adjustmentDefizit-Schulden-Anpassung
838unfunded pension planumlagefinanziertes Altersversorgungssystem
839harmonised long-term interest rateharmonisierter langfristiger Zinssatz
840large-value paymentGrossbetragszahlung
841link between securities settlement systemsVerbindung zwischen Wertpapierabrechnungssystemen
842measure with a temporary effectMassnahme mit zeitlich begrenzter Wirkung
843one-off effectone-off-Effekt
844self-reversing effectself-reversing-Effekt
845net capital expenditureNettokapitalausgaben
846IMFCInternationaler Währungs- und Finanzausschuss
847call clausePari-Rückkaufs-Klausel
848frontloadingVorabausstattung
849G20G20
850ETSCETSC
851single passportEinmalzulassung
852acceptance of the euroAkzeptanz des Euro
853PRSPPRSP
854PRGFArmutsbekämpfungs- und Wachstumsfazilität
855euro central rateEuro-Leitkurs
856HIPC Trust FundHIPC-Treuhandfonds
857Eurosystem’s foreign reserve assetsWährungsreserven des Eurosystems
858NIIPNIIP
859FSFFSF
860convergence reportKonvergenzbericht
861counterfeiting of the euroFälschung des Euro
862CNACMAZ
863National Counterfeit CentreNationales Zentrum für Fälschungsbekämpfung
864CCDFalschgeld-Datenbank
865Guideline of the European Central BankLeitlinie der Europäischen Zentralbank
866NACNAZ
867precautionary arrangementVorsorgliche Kreditvereinbarung
868MTEFmittelfristiger Finanzrahmen
869subfrontloadingVorverteilung, Vorabausstattung
870seriesSeriennummer
871note numberlaufende Nummer
872Cash Changeover CommitteeCashCo
873cash changeoverBargeldumstellung
874enhanced HIPC initiativeerweiterte HIPC-Initiative
875constituencyGruppenvertretung
876competitive devaluationAbwertungswettlauf
877liability of general governmentVerbindlichkeit des Sektors Staat
878Agreement of 13 March 1979 between the central banks of the Member States of the European Economic Community laying down the operating procedures for the European Monetary SystemAbkommen vom 13.März 1979 zwischen den Zentralbanken der Mitgliedstaaten der Europäischen Wirtschaftsgemeinschaft über die Funktionsweise des Europäischen Währungssystem
879common currencygemeinsame Währung
880EMAEWA
881oz tFeinunze
882inflationInflation
883SBAStand-by-Abkommen
884domestic currencyLandeswaehrung
885benchmark rateBardevisenkurs
886capital controlBeschränkungen des Kapitalverkehrs
887disinflationDisinflation
888deflationDeflation
889equivalent of the EUA in a Community currencyGegenwert der ERE in einer Gemeinschaftswaehrung
890instrument of monetary policyInstrument der Geld-und Währungspolitik
891common face of euro coinsgemeinsame Seite der Euro-Münzen
892national face of euro coinsnationale Seite der Euro-Münzen
893in countryIns
894direct inflation targetingdirektes Inflationsziel
895liquidity crisisLiquiditätskrise
896formal agreement on an exchange-rate system for the ECUförmliche Vereinbarung über ein Wechselkurssystem für den ECU
897allocation of monetary income of national central banksVerteilung der monetären Einkünfte der nationalen Zentralbanken
898the amount of each national central bank’s monetary income shall be reduced by an amount equivalent to any interest paid by that central bankder Betrag der monetären Einkünfte einer jeden nationalen Zentralbank vermindert sich um den Betrag etwaiger Zinsen,die von dieser Zentralbank gezahlt werden
899clearing and settlement of the balances arising from the allocation of monetary incomeVerrechnung und Ausgleich der Salden aus der Verteilung der monetären Einkünfte
900CMFBAusschuss für die Wahrungs-,Finanz-und Zahlungsbilanzstatistiken
901monetary incomemonetäre Einkünfte
902cash flowcash flow
903instalmentRatenzahlung
904reserve prescribed by articlesstatutarische Rücklage
905security vanGeldtransportauto
906meeting of the IMF Interim CommitteeTagung des IWF-Interimsausschusses
907statutory reservegesetzliche Rücklage
908cover paymentDeckungszahlung
909counterpartGegenposten
910current account surplusLeistungsbilanzüberschuss
911inflow of liquidityLiquiditätszufluss
912South Korean wonKRW
913renminbi-yuanCNY
914nominal exchange ratenominaler Wechselkurs
915NRPNRP
916non-cash changeoverBuchgeldumstellung
917ESFFazilität für exogene Schocks
918EurepoEurepo
919Engraver GeneralChefgraveur
920TARGET2TARGET 2
921financial crisisFinanzkrise
922FCLFlexible Kreditlinie
923TTFthematischer Treuhandfonds
924covered short salegedeckter Leerverkauf
925admit to trading on a trading venuezum Handel an einem Handelsplatz zulassen
926financial assistance packageFinanzhilfepaket
927monetary policy functionwährungspolitische Aufgabe
928Euro Plus PactEuro-Plus-Pakt
929EWGArbeitsgruppe “Euro-Gruppe”
930macro-structural country surveillancemakrostrukturelle Länderüberwachung
931accumulated reserveskumulierte Rücklagen
932implicit liabilitiesimplizite Verbindlichkeiten
933re-budgetingWiedereinstellung der Mittel
934privatisation proceedsPrivatisierungserlös
935financial spilloverfinanzieller Ausstrahlungseffekt
936net foreign asset positionNettoauslandsposition
937precautionary lendingGewährung einer vorsorglichen Kreditlinie
938Groupe de FrancfortFrankfurter Gruppe
939UNEP FIFinanzinitiative des UN Umweltprogramms
940Board of GovernorsESM-Gouverneursrat
941European sovereign debt crisisStaatsanleihekrise im Euroraum
942fiscal capacityFiskalkapazität
943direct bank recapitalisationdirekte Bankenrekapitalisierung
944eurobillEuro-Anleihe
945GEMUechte WWU
946currency warWährungskrieg
947Data Gaps InitiativeInitiative der G-20-Staaten zu Datenlücken
948allocated goldGold in Einzelverwahrung
949unallocated goldGold in Sammelverwahrung
950Board of DirectorsDirektorium
951ERPBEPRB
952Vice-President for the Euro and Social DialogueVizepräsident für den Euro und den sozialen Dialog
953AIIBAIIB
954ANFAANFA
955CMCGeldversorgungsunternehmen
956Board of DirectorsDirektorium

 

 

 

SIGN IN

Forgot Password

X