load-page

Terminology English – German 2411 monetary economics

Home/Chưa được phân loại/Terminology English – German 2411 monetary economics
Terminology English - German 2836 social protection

Inter Active Terminology of Europe

Terms English – German 2411 monetary economics

Domain: 24 FINANCE

Subdomain: 2411 monetary economics

 

No

English US

German DE

1reproductionReproduktion
2authentification featureSicherheitsmerkmal
3banknote seriesBanknotenserie
4coin issuanceAusgabe von Münzen
5mintMünze
6mintMuenzen praegen
7banknote processing unitBanknotenbearbeitungsstelle
8numeralZahl
9coins in circulationim Umlauf befindliche Münzen
10CYPCYP
11DKKDKK
12SEKSEK
13instrument of paymentZahlungsdokument
14electronic money issuerAusgabe von elektronischem Geld
15electronic money holderE-Geld-Inhaber
16fixed-rate instrumentfestverzinslicher Schuldtitel
17inverse floating rate instrumentInverse Floater
18floating rate instrumentFloater
19earmarking systemKennzeichnungsverfahren
20collateral pooling systemPfandpoolverfahren
21GBPGBP
22LVLLVL
23EEKEEK
24ISKISK
25ROLROL
26CHFCHF
27South African randSüdafrikanischer Rand
28NOKNOK
29liquid assetflüssige Mittel
30retail payment systemMassenzahlungssystem
31BGNBGN
32CBRTtürkische Zentalbank
33contingency measureNotfallmaßnahme
34economy of scaleGrößenkostenersparnis
35euro-currencyEuro-Währung
36promissory noteEigenwechsel
37(dollar bloc)Dollar-Raum
38legal tenderschuldbefreiende Wirkung
39CIRRCIRR
40DDRDAS
41monetary coefficientWährungskoeffizient
42switch-over systemswitch-over-System
43artificial MCAskünstliche WAB
44natural MCAsnatürliche WAB
45real monetary gaprealer Währungsabstand
46ACABeitrittsausgleichsbetrag
47Articles of Agreement of the International Monetary FundAbkommen über den Internationalen Währungsfonds
48assets created as a counterpart to the deposit with the EMCF of gold and dollarsGuthaben entstehen gegen Einzahlung beim EFWZ von Gold und Dollar
49working balancesBetriebsguthaben
50basic balance of paymentsGrundzahlungsbilanz
51exchange brokerBörsenmakler
52debit balanceSchuldsaldo
53deflationDeflation
54currency depreciationAbwertung der Währung
55Managing Director of the IMFgeschäftsführender Direktor des IWF
56ex-post analysisEx-post-Analyse
57extension of medium term creditAusweitung mittelfristiger Kredite
58franc for trade operationsHandels-Franc
59gold assetsGoldbestand, Goldreserve
60gold standardGoldstandard
61to establish a grid of bilateral exchange ratesein Gitter von bilateralen Wechselkursen festlegen
62gross dollar assetsBruttodollarreserven
63holdingsGeldbestände
64hot moneyvagabundierendes Kapital
65compulsory intervention ratesPflichtinterventionskurs
66bank lendingAusleihungen der Banken
67settlement of liabilitiesAusgleich von Schulden
68lombard rateLombardsatz
69matching assets ruleKongruenzregel
70parity ratesParitätsverhältnisse
71flexible exchange rateflexibler Wechselkurs
72floating rates systemSystem floatender Wechselkurse
73floating-rate loanAnleihe mit variablem Zinssatz
74debt ratioSchuldenquote
75ECU created against reserve assetsgegen Hinterlegung von Reserveinstrumenten geschaffene ECU
76specified revolving swap arrangementsspezifische Swap-Revolving-Abkommen
77market-control priceRichtpreis
78Board of Governors of the European Monetary Cooperation FundVerwaltungsrat des Europäischen Fonds für währungspolitische Zusammenarbeit
79central amountLeitbetrag
80carousel fraudKarussellbetrug
81carenciaKarenzfrist
82$$
83parallel currencyParallelwährung
84budget overrunAusbrechen aus dem festgelegten Haushaltsrahmen
85to activate drawing rightsZiehungsrechte aktivieren
86Community assetgemeinschaftliches Aktivum
87total and irreversible convertibility, at irrevocable paritiesuneingeschränkte, irreversible …
88deposit of reserve assetsHinterlegung von Reserven
89devaluationAbwertung
90diameterDurchmesser
91drawing rightZiehungsrecht
92maximum spread of divergence for each currencymaximale Abweichungsspanne
93continuing issueDaueremission von Schuldverschreibungen
94cashBargeld
95correcting factorBerichtigungsfaktor
96monetary gapWährungsabstand
97semi-public financial institutionhalbstaatliches Kreditinstitut
98freely convertible currencyfrei austauschbare Währung
99mobilisation of the claimMobilisierung der Forderung
100means of settlementSaldenausgleich
101reconstitution obligationRekonstitutionsverpflichtung
102outright transactionOutright-Geschäft
103basket systemKorbsystem
104global loanGlobaldarlehen
105presumption to actErwartung des Handelns
106creditor central bankkreditgebende Notenbank
107Treasury billSchatzanweisung
108quality standardGütenorm
109EMAEWA
110country riskLänderrisiko
111billionMilliarde
112market makerMarktmacher
113MTFAMFB
114terms of tradeAustauschverhältnis im Aussenhandel
115ISINISIN
116maximum spot marginmaximale Bandbreite
117exchange arrangementsBestimmungen über den Zahlungsverkehr
118crawling pegflexible Wechselkurse
119economic agentMarktteilnehmer
120inflationary gapinflatorische Lücke
121fall in the value of moneyGeldentwertung
122DCEinländische Kreditausweitung
123currency basketKorbwährung
124recycling of capitalRecycling
125central rateLeitkurs
126EMCFEFWZ
127TTERDTC
128SDRSZR
129exchange riskFremdwährungsrisiko
130base rateBasiszinssatz (beim CIRR)
131G-24G 24
132NCINGI
133CAAusgleichsabgabe
134MCAWAB
135creditor rallongeGläubigerrallonge
136general payments system of the Member Statesalgemeiner Zahlungsverkehr der Mitgliedstaaten
137official gross reservesamtliche Bruttoreserven
138WAMUWAMU
139STMSKWB
140stability in exchange rate relationshipsWechselkursstabilität
141nominal market ratenominaler Marktkurs
142standby creditBeistandskredit
143near-moneyGeldsubstitute
144exchange rate volatilityWechselkursschwankungen (Pl.)
145a further elaboration and concretisation of the present Reportnähere und konkretere Ausführungen zu diesem Bericht
146the constellation of financial and banking centres in Europedie Lage der europäischen Finanz- und Bankzentre
147committee for monetary policy analysisUnterausschuss für geldpolitische Analyse
148an additional intervention windowein zusätzliches Interventionsfenster
149a Monetary Policy Departmenteine Abteilung für Geldpolitik
150a Foreign Exchange and Reserve Management Departmenteine Abteilung für Devisen- und Reservenpolitik
151the Monetary Policy Committeeder Ausschuss für Geldpolitik
152the Committee on Banking Supervision Policyder Ausschuss für Bankenaufsicht
153the Foreign Exchange Policy Committeeder Ausschuss für Devisenpolitik
154Executive Committeegeschäftsführender Vorstand
155a Board of Directorsein Direktorium
156training groundeine Art Übungsfeld
157the creation of a European Reserve FundEuropäischer Reservefonds
158common surveillance indicatorsgemeinsame Überwachungsindikatoren
159the gradual crowding-out of national currencies by the ecudie ECU würde die nationalen Währungen allmählich verdrängen
160discrete but evolutionary stepsBehutsame, doch evolutionäre Schritte
161their executive and policing functionsDurchführungs- und Kontrollaufgaben
162the Chairman of the ESCBder Präsident des EZBS
163establishment of a BoardEinsetzung eines Direktoriums
164establishment of an ESCB CouncilEinsetzung eines EZBS-Rates
165open market operation in government securitiesOffenmarktgeschäft mit Staatspapieren
166wage formationLohnbildung
167national currencies would become increasingly close substitutes… würden die nationalen Währungen zu immer engeren Substituten
168an overall policy stanceein gesamtpolitischer Kurs
169macroeconomic managementdie makroökonomische Steuerung
170concrete stages leading towards the progressive realisation of economic and monetary unionkonkrete Stufen zur schrittweisen Verwirklichung einer Wirtschafts- und Währungsunion
171to enhance the Community’s monetary capacitydie währungspolitischen Befugnisse der Gemeinschaft … vergrössern
172the ecu’s appeal as a near money substitutedie ECU als nahes Substitut (…) (nur wenig) attraktiv ist
173ecu-denominated depositdie auf ECU lautenden Einlagen
174ECU clearing systemEcu-Verrechnungssystem
175a means of portfolio diversificationMittel zur Portfolio-Diversifizierung
176foreign exchange policy subcommitteeUnterausschuss für Devisenpolitik
177monetary policy subcommitteeUnterauschuss für Geldpolitik
178regulatory powersregulative Befugnisse
179use of the ecu to denominate operations in the intervention and credit mechanismsVerwendung der ECU als Rechengrösse für Operationen im Interventions- und Kreditmechanismus
180use of the ecu as denominator of the exchange-rate mechanismVerwendung der ECU als Bezugsgrösse für den Wechselkursmechanismus
181the autonomous (wage) negotiating processdie Tarifautonomie
182market-oriented economic principlesmarktwirtschaftliche Prinzipien
183elimination of margins of fluctuationBeseitigung der Bandbreiten
184African Development Fund Unit of AccountFUA
185EMUAEWRE
186DERTageskurs
187reference zoneReferenzzone
188the most extensive legal capacity accorded to legal persons (under its law)weitestgehende Rechts- und Geschäftsfähigkeit, die juristischen Personen nach den Rechtsvorschriften zuerkannt ist
189monetary capacitywährungspolitische Befugnisse
190consistencyKohärenz
191consolidated balance sheetkonsolidierte Bilanz
192class of sharesAktiengattung
193revaluationAufwertung
194dismantlement (monetary compensatory amounts)Abbau der Währungsausgleichbeträge
195face valueNennbetrag
196legal tendergesetzliches Zahlungsmittel
197foreign currencyFremdwährung
198multilateral surveillancemultilaterale Überwachung
199investment in fixed capitalAnlageinvestition
200mechanism for short-term monetary supportSystem des kurzfristigen Währungsbeistands
201MMillion
202creditor quotaGläubigerquote
203additional reservefreie Rücklage
204Alternate Members of the Monetary CommitteeStellvertreter des Währungsausschusses
205cost-push inflationKostendruckinflation
206seigniorageMünzgewinn
207EurofedEurofed
208Plaza accordPlaza-Abkommen
209CLIOCLIO
210the ecu (plural : the ecus)die ECU
211debt management policyöffentliche Schuldenpolitik
212covered by non-monetary meansüber den Kapitalmarkt finanziert
213to mop up excess liquidityüberschüssige Liquidität abschöpfen
214absorption of central bank balancesAbsorption von Zentralbankguthaben
215degree of divergenceAbweichungen
216agri-monetary regulationsagromonetäre Verordnungen
217savings in equitiesAktiensparen
218official settlementsamtliche Transaktionen, offizielle Reservetransaktionen
219securities dealt in on a stock exchangean Börsen gehandelte Wertpapiere (1)
220supply-side measuresangebotsorientierte Massnahmen
221rate of fixed investmentAnlageinvestitionsquote
222external foreign currency positionsauf Fremdwährungen lautende Auslandspositionen
223guilder notesauf Gulden lautende Euro-Darlehen
224SDR-denominated liabilitiesauf SZR lautende Verbindlichkeiten
225emergence of exogenous disturbancesAuftreten exogener Störungen
226revaluationAufwertung
227central government expenditureAusgaben des Zentralstaates
228settlement of the positionsAusgleich der Salden
229compensatory operations to control liquidityausgleichende Liquiditätssteuerung
230means of settlementAusgleichsmedium
231payable to/receivable from Member States for adjustment of capitalAusgleichverbindlichkeiten gegenüber/Ausgleichsforderungen an Mitgliedstaaten
232external indebtednessAuslandsverschuldung
233external balanceAußenbeitrag
234external capital flowsaussenwirtschaftliche/aussenwirtschaftlich bedingte Kapitalbewegungen
235balance of payments imbalancesaussenwirtschaftliches Ungleichgewicht
236exceptional disturbancesaussergewöhnliche Störungen
237money market instrumentGeldmarktinstrument
238unpaid capitalausstehende Einlagen auf das Grundkapital
239expansion of creditAusweitung des Kreditvolumens
240automatic renewalautomatische Verlängerung
241bank liquidityBankenliquidität
242currency in circulationBargeld im Umlauf
243liquidityLiquidierbarkeit
244cash reservesBarreserven
245limited split of the foreign exchange marketsbegrenzte Spaltung des Devisenmarktes
246calculation of the ceilingBerechnung der Plafonds
247reference rateBezugssatz
248bilateral limitbilateraler Interventionspunkt
249accounting relationshipsbuchungstechnische Beziehungen, Bilanzzusammenhang
250meeting of any shortfallDeckung von Verlusten
251demand pull inflationNachfrageinflation
252the dollar as a vehicle and reserve currencyder Dollar als Transaktionswährung
253destabilising effectdestabilisierendee Einfluss
254foreign currenciesDevisen
255foreign exchangeDevisen
256foreign exchange outflowsDevisenabflüsse
257currency arbitrageDevisenarbitrage
258foreign currency offset agreements with the U.S.Devisenausgleichsabkommen mit den USA
259foreign exchange earningsDeviseneinnahmen
260advances in foreign currencyDevisenkredite
261exchange marketDevisenmarkt
262exchange restrictionsZahlungsbeschränkungen (2)
263inflow of foreign exchangeDevisenzufluss, Devisenzugang
264the effects of the increase may be neutraliseddie Anhebung kann in ihrer Zielsetzung unterlaufen werden
265discount marketDiskontmarkt
266DIAbweichungsindikator
267divergence thresholdAbweichungsschwelle
268threshold of divergence/divergence thresholdAbweichungsschwelle
269triangular financing operations/schemesDreiecksfinanzierung
270third currenciesDrittländerwährungen (2)
271ECU basket (formula)ECU-Korbformel
272to reduce exchange rate fluctuationsEindämmung der Wechselkursschwankungen
273to discontinue the listing of the securityEinstellung der amtlichen Notierung eines Wertpapieres
274expected rate of inflationerwartete Inflationsrate
275fine tuningFeinabstimmung
276fixed exchange rate relationshipsfester Wechselkursverbund
277monetary targetingFestlegung von Geldmengenzielen
278financial variablesfinanzielle Variablen
279general government net borrowingFinanzierungsdefizit des Gesamtstaates
280financial intermediariesFinanzinstitute
281free liquid reservesfreie Liquiditätsreserven
282flexible exchange ratesflexible Wechselkurse
283floating exchange rateflexibler Wechselkurs
284foreign currency liabilitiesFremdwährungsverbindlichkeiten
285functional relationshipsfunktionelle Beziehungen
286non-residentDevisenausländer
287financial assetsFinanzaktiva
288demand for moneyGeldbedarf
289money market paperGeldmarktpapier
290interest rate on money marketGeldmarktsatz
291monetary expansionGeldmengenexpansion (1)
292monetary aggregateGeldmengenaggregat
293monetary supply growthGeldmengenwachstum
294personal sector’s liquid assetsgeldnahe Aktiva der Haushalte
295monetary normsgeldpolitische Normen (1)
296flow of fundsGeldströme
297secondary liquidityGeld- und Quasigeldmenge
298monetary growthGeldmengenwachstum
299primary liquidityGeld- und Quasigeldvolumen
300money and quasi-moneyGeldvolumen und Quasigeldbestände
301Community exchange rate systemgemeinschaftliches Wechselkurssystem
302total nominal valueGesamtnennbetrag
303dual exchange marketgespaltener Devisenmarkt
304vending machineGetränkeautomat
305weight in the ECU basketGewichtungskoeffizient im ECU-Korb
306creditor countryGläubigerland
307gold transactionsGoldgeschäfte
308degree of “moneyness”Grad an Geldqualität
309block floatBlockfloating, gemeinsames Floaten
310claims on the central bankGuthaben bei der Zentralbank
311tightening of monetary policyHärtung der Geldpolitik/des geldpolitischen Kurses
312appreciation of a currencyAufwertung
313commercial banksHandelsbanken
314erratic movementserratische Kursausschläge
315under repurchase agreements (swaps)im Rahmen von Swap-Vereinbarungen
316drawing on the credit facilitiesInanspruchnahme der Kreditfazilitäten
317currency in oppositionin der Gegenposition stehende Währung
318indexation mechanismIndexierungsmechanismus
319induced changesinduzierte Veränderungen
320inflation rateInflationsrate
321bout of inflationInflationsanstoss
322inflationary overheatinginflatorische Überhitzung
323residentEinwohner
324domestic expenditureinländische Ausgaben
325total domestic creditgesamte(r) inländische(r) Kredit/Kreditgewährung
326denominated in national or in foreign currenciesauf Landes- oder Fremdwährung lautend (2)
327domestic creditInlandskredite
328domestic and foreign liabilitiesInlands- und Auslandsverbindlichkeiten
329overall economic management/management of the economyInstrumente der Globalsteuerung
330means of offsetting the social consequencesInstrument zum Ausgleich der sozialen Folgen
331international bond marketsinternationale Rentenmärkte
332domestic liquidityInlandsliquidität
333intervention on the foreign exchange marketIntervention am Devisenmarkt
334intervention currencyInterventionswährung
335CAPEXInvestitionsaufwendungen
336G 24Gruppe der 24 Industrieländer
337restrictions on outflows of capitalKapitalexportbeschränkungen
338lenders and borrowersKapitalgeber und Kapitalnehmer
339capital-deepening investmentVerbesserungsinvestition
340capital market borrowingKapitalmarktmittel
341capital market rateKapitalmarktzinssatz
342personal capital movementsKapitalverkehr mit persönlichem Charakter
343exchange risk coverDeckung des Wechselkursrisikos
344cyclical fluctuationsKonjunkturschwankungen
345contrasting colourKontrastfarbe
346global credit approachKonzept der gesamten Kreditgewährung
347overdraft systemKreditüberziehungssystem
348credit facilitiesKreditmöglichkeiten
349ceilings for creditsBereitstellungsplafonds
350monetary controlGeldmengensteuerung
351monetary policy meansgeld- und kreditpolitische Massnahmen
352credit rationingKreditrationierung
353credit targetsKreditziele
354day to day monetary managementkurzfristige Geldpolitik
355short-term liquid assetskurzfristige liquide Anlagen
356short-term liabilitieskurzfristige Verbindlichkeiten
357short-term interest rateskurzfristiger Zins
358daily rate for conversionTagesumrechnungskurs
359realignmentAnpassung der Leitkurse
360base ratesLeitzinsen
361liquid savingsliquide Ersparnisse
362base assetsliquide Mittel
363monetary and other financial assetsliquide Mittel und nicht im Geldvolumen erfasste finanzielle Aktiva
364liquidity of the economyLiquidität der Wirtschaft
365excess liquidityLiquiditätsüberhänge
366loss of liquidityLiquiditätsentzug (1)
367liquidity ratio of the economyLiquiditätsrate der Wirtschaft
368marketable securitiesmarktgängige Titel
369market forcesMarktkräfte
370official stock exchange marketMarkt mit amtlicher Notierung
371anti-inflationary measuresMassnahmen zur Inflationsbekämpfung
372minimum reserve requirementsMindestreservepflicht
373to release fundsMittel freigeben
374monetary financingFinanzierung der Geldschöpfung
375monetary indicatormonetärer Indikator
376monetary resourcesmonetäre Ressourcen
377monetary restrictionsgeld- und kreditpolitische Restriktionen (2)
378techniques of monetary controlgeldpolitisches Instrumentarium
379monetary objectiveGeldmengenziel
380monetary cooperationmonetäre Zusammenarbeit
381lead accountingnachperiodische Berechnungsweise
382close to unitynahezu eins
383negative interest rateNegativzinsen (pl.)
384net financial positionNettofinanzierungsposition
385non-banksNichtbanken
386non-bank sectorNichtbanken
387non-bank private sectorsNichtbanken des privaten Sektors
388non-monetary factorsnicht-monetäre Faktoren
389non-monetary meansgeldmengenneutrale Mittel (2)
390non-monetary savings medianichtmonetäre Sparmedien
391unpredictable swings in cash flowsnichtvorausbestimmbare Schwankungen in den Zahlungsströmen
392offshore branchesNiederlassungen ausserhalb Grossbritanniens
393nominal interest rateNominalzins
394numeraireNumeraire
395unused credit linesoffene Kreditzusagen
396to re-establish par valuesParitäten neu festsetzen
397quantitative monetary policy objectivesquantitative geldpolitische Ziele
398quasi-capitalQuasi-Kapital
399repurchase of securitiesRückkauf von Wertpapieren
400real sectorrealer Sektor
401EMS realignmentAnpassung im EWS
402range of monetary indicatorsReihe monetärer Indikatoren
403yield differentialRenditenabstand
404eligible liabilitiesberücksichtigungsfähige Verbindlichkeiten
405IMF reserve positionIWF-Reserveposition
406reserve ratioMindestreservesatz
407austerity policyAusteritätspolitik
408roundingRunden der Zahlen
409rounding-off differenceRundungsdifferenz
410balance on current accountsLeistungsbilanzsaldo
411creation of monetary baseSchöpfung von Zentralbankgeld
412treasury paperSchatzwechsel
413debt servicingSchuldendienst
414debtor countrySchuldnerland
415debt certificateSchuldverschreibung
416floating rate notesSchuldverschreibungen mit variablen Zinssätzen
417margin of fluctuation for the currenciesBandbreite der Währungen (2)
418variability of exchange ratesSchwankungsbreite der Wechselkursbewegungen
419fluctuation reserveSchwankungsreserve
420self-financingSelbstfinanzierung
421significant figuressignifikante Zahlen
422special reservesSonderrücklage
423public budgetStaatshaushalt
424stagflationStagflation
425fall in the exchange rateKursverlust einer Währung
426statistical seriesstatistische Reihen
427fiscal dragSteuerdrift
428penalty rateStrafsatz
429substitution accountSubstitutionskonto
430supplementary special deposit scheme or “corset”supplementary special deposit scheme, das sog. Korsett
431dual-guarantee systemSystem der doppelten Garantie
432mechanism for very short-term financingSystem der sehr kurzfristigen Finanzierung
433system of so-called target zones expressed in effective exchange ratesSystem so genannter Zielzonen in Form effektiver Wechselkurse
434participating currencyTeilnehmerwährung
435mandatory reserve requirementMindestreservesatz
436portfolio investmentPortfolioinvestition
437preferential ratePräferenzbeteiligungssatz
438primary liquidityPrimärliquidität
439loss of outputProduktionseinbussen
440bracketMarge
441velocity of circulationUmlaufgeschwindigkeit
442conversion rateUmrechnungskurs
443rescheduling of the external debtUmschuldung von Auslandsschulden
444depreciation below the target zoneUnterschreitung der Zielzone
445variability of interest ratesveränderliche Zinssätze
446closed bond (or “0” guilder circuit)O-Guldenkreislauf
447crowding-out effectVerdrängungseffekt
448renewal by mutual agreementVerlängerung im gegenseitigen Einvernehmen
449narrowing of the margins of fluctuationVerringerung der Bandbreiten
450switchVerschiebungen (pl.)
451external indebtednessAuslandsverschuldung (3)
452ECU as a denominator for loans floated by the Community institutionsECU als Numeraire für Anleihen der Europäischen Institutionen
453lagged accountingvorperiodische Berechnungsweise
454advance redemptionvorzeitige Ablösung
455monetary authoritiesWährungsbehörden
456denominationWährungseinheit
457monetary goldWährungsgold
458monetary policyGeld- und Währungspolitik
459monetary disturbancesWährungsunruhen
460adjustment of central ratesAnpassung der Wechselkurse
461exchange rate relationsWechselkursbeziehungen
462exchange guaranteeWechselkursgarantie
463exchange parityWechselkursparität
464exchange rate fluctuationWechselkursschwankungen
465re-lending of fundsWeitergabe von Mitteln
466economic fundamentalsgesamtwirtschaftliche Eckdaten
467money supplyWirtschaftsliquidität, Liquidität der Wirtschaft
468housebuildingWohnbau
469housing financeWohnungsbaufinanzierung
470subscription applicationZeichnungsantrag
471high-powered moneyGeldbasis
472central bank moneyNotenbankgeld
473central numérairezentraler Wertmassstab
474target variableZielgrösse
475monetary growth target rangeZielmarge für die Geldmengenexpansion
476target rangeZielkorridor
477interest arbitrage transactionsZinsarbitrage
478interest shortfallZinsfehlbetrag
479interest rate differentialZinsabstand
480economic and monetary policyWirtschafts- und Währungspolitik
481investorsAnlegerpublikum, Anlegerkreise (pl.)
482Working Party on Short-Term Capital MovementsArbeitsgruppe (des Währungsausschusses) “Kurzfristige Kapitalbewegungen”
483upward pressureAufwärtsdruck
484market interest rateMarktzins
485outstanding amountsBestand
486discount houseDiskonthaus
487disinflationDesinflation
488exchange restrictions on the movement of capitaldevisenrechtliche Beschränkungen des Kapitalverkehrs
489consortium operationKonsortialfinanzierung
490Euro-loanEurokredite (pl.)
491galloping inflationgaloppierende Inflation
492countermeasureGegenmassnahmen (pl.)
493monetary/money creation (by the banks)Geldschöpfung
494domestic creditInlandskredit
495global creditGlobalkredit
496weights of currenciesGewichte der Währungen
497scriptural moneyBuchgeld (2)
498trade creditHandelskredit
499international reserve assetinternationale Reservemedien (pl.) (1)
500NCLandeswährung
501compulsory reservesMindestreserven
502minimum reservesMindestreserven
503reserve requirementMindestreservepflicht
504creditMittel, Haushaltsmittel, Mittelansätze, Ausgabenansätze, Kredit, Kredite
505monetary controlkreditpolitische Kontrolle
506monetary restrictionmonetäre Restriktion
507multiple rates of exchange/exchange ratesmultiple Wechselkurse
508net external positionNettoauslandsposition
509real rate of interest/interest rateEffektivverzinsung
510reserve assets ratioRAR
511revolving characterrevolvierender Charakter
512creeping inflationschleichende Inflation
513fluctuation bandBandbreite
514Swiss francSchweizer Franken
515ECBEZB
516SDR basketSRZ-Korb
517support purchasesStützungskäufe
518Exchequer foreign borrowingstaatliche Kreditaufnahme im Ausland
519sharp squeezestarke Verknappung
520deferment of amortisationTilgungsaufschub
521conversion algorithmUmrechnungsregel
522investigatory powersUntersuchungsbefugnis
523settlement systemVerrechnungssystem
524capital flightEinlagenflucht
525central bank money stock (CBM)Zentralbankgeldmenge
526long-term interest rateKapitalmarktsätze (4)
527corsetzusätzliche Sondereinlagen
528parity gridParitätengitter
529unused refinancing facilitiesunausgenutzte Refinanzierungslinien
530MCAWAB
531new monetary institutionneue monetäre Institution
532single currencyeinheitliche Währung
533Group of Personal RepresentativesGruppe der persönlichen Beauftragten
534its objectives of internal and external monetary stabilityseine Ziele der inneren und äusseren Währungsstabilität
535the exchange rate constraintdie vom Wechselkursmechanismus ausgehenden Zwänge
536the ECU serves primarily as a reserve asset and a means of settlement for EMS central banksdie ECU dient hauptsächlich als Reservemedium und Instrument für den Saldenausgleich zwischen den Zentralbanken des EWS
537a broadly balanced developmenteine im ganzen ausgewogene Entwicklung
538budgetary positionsdie Positionen der öffentlichen Haushalte
539mutually consistent macro-economic policieseine wechselseitig konsistente makroökonomische Politik
540a more balanced economic structure throughout the Communityeine ausgewogenere Wirtschaftsstruktur in der gesamten Gemeinschaft
541unsustainable differences between individual member countriesuntragbare Unterschiede zwischen den einzelnen Mitgliedsländern
542the creation of a single currency areadie Schaffung eines einheitlichen Währungsraums
543remove intra-Community exchange rate uncertainties (… and) eliminate exchange rate variabilitydie Unsicherheit über die innergemeinschaftlichen Wechselkurse beseitigen (… und) die Variabilität der Wechselkurse ausschalten
544to enhance the process of resource allocation in those economic sectors and geographical areas where the working of market forces needed to be reinforced or complementedzur Verbesserung der Ressourcenallokation in solchen Branchen und Regionen, in denen die Marktkräfte verstärkt oder ergänzt werden müssen
545hard ecuharter Ecu
546EFTelektronischer Zahlungsverkehr
547overdraft or any other type of credit facilityÜberziehungs- oder Kreditfazilität
548penalty interestStrafzinsen
549foreign-exchange assetsDevisen
550Rules governing the size and the financing of national budget deficitsRegeln über den Umfang und die Finanzierung nationaler Haushaltsdefizite
551to facilitate the financing of economic imbalancesdie Finanzierung wirtschaftlicher Ungleichgewichte erleichtern
552a common overall assessment of the short-term and medium-term economic developments in the Communityeine gemeinsame Gesamtbeurteilung der kurz- und mittelfristigen wirtschaftlichen Entwicklung der Gemeinschaft
553to exclude access to direct central bank credit and other forms of monetary financingden Zugang zu Zentralbankkrediten und anderen Formen monetärer Finanzierung ausschliessen
554appropriate delegation of authorityangemessene Kompetenzübertragung
555formulating and implementing monetary policy as well as managing the Community’s exchange rate policy vis-à-vis third currenciesdie Erarbeitung und Umsetzung der Geldpolitik und die Handhabung der Wechselkurspolitik der Gemeinschaft gegenüber Drittwährungen
556exchange rate and reserve managementdie Wechselkurssteuerung und die Verwaltung der Währungsreserven
557the provision not to lend to public-sector authoritiesdie Vorschrift, keine Kredite an öffentliche Stellen zu gewähren
558a supervisory council or a committee of independent auditorsein Aufsichtsrat oder ein Ausschuss unabhängiger Rechnungsprüfer
559exchange controlDevisenkontrolle, Devisenbewirtschaftung
560exchange authorisationdevisenrechtliche Genehmigung
561pre-emptionBezugsrecht
562non-inflationary economic growthinflationsfreies Wirtschaftswachstum
563economic governmentWirtschaftsregierung
564abnormal capital movementsanomale Geldbewegungen
565supervisory authoritiesAufsichtsbehörden
566weighted votingAbstimmung mit Stimmgewichtung
567VSTFsehr kurzfristige Finanzierung
568irrevocably fixed exchange ratesunwiderruflich festgelegte Wechselkurse
569external borrowingKreditaufnahme im Ausland
570other holdersonstiger Halter
571ratio of planned or actual government deficit to gross domestic productVerhältnis des voraussichtlichen oder tatsächlichen öffentlichen Defizits zum Bruttoinlandsprodukt
572holding and management of the official foreign reservesHaltung und Verwaltung der offiziellen Währungsreserven
573Governing CouncilEZB-Rat
574freedom of paymentsFreiheit des Zahlungsverkehrs
575monetary incomemonetäre Einkunfte
576overall orientation of monetary policy and exchange-rate policyallgemeine Orientierung der Geld- und der Wechselkurspolitik
577BEFbelgischer Franc
578Rules governing the Monetary CommitteeSatzung des Währungsausschusses
579issue coinsAusgabe von Münzen
580assets held against notes in circulationVermögenswerte als Gegenposten zum Bargeldumlauf
581General CouncilErweiterter Rat der EZB
582stock of government debtHöhe des öffentlichen Schuldenstands
583maximum permissible ratios between those reserves and their basishöchstzulässige Relationen zwischen diesen Mindestreserven und ihrer Basis
584allocation of net profits and losses of the ECBVerteilung de Nettogewinne un Verluste der EZB
585clearing and payment systemsVerrechnungs- und Zahlungssysteme
586current exchange ratesjeweiliger Wechselkurs
587foreign-exchange working balancesArbeitsguthaben in Fremdwährungen
588reporting requirementsBerichtspflichten
589intermediate monetary objectivegeldpolitische Zwischenziele
590supply of reservesBereitstellung von Zentralbankgeld
591bilateral central ratebilateraler Leitkurs
592average nominal long-term interest ratedurchschnittlicher langfristiger Nominalzinssatz
593Protocol on DenmarkProtokoll betreffend Dänemark
594Protocol on PortugalProtokoll betreffend Portugal
595Protocol on the transition to the third stage of economic and monetary unionProtokoll über den Übergang zur dritten Stufe der Wirtschafts- und Währungsunion
596Protocol on certain provisions relating to DenmarkProtokoll über einige Bestimmungen betreffend Dänemark
597Protocol on FranceProtokoll betreffend Frankreich
598Chairman (Monetary Committee)Präsident (Währungsausschuss)
599irrevocable fixing of exchange ratesunwiderrufliche Festlegung der Wechselkurse
600single monetary policy and exchange-rate policyeinheitliche Geld- und Wechselkurspolitik
601sound monetary conditionsgesunde Monetäre Rahmenbedingungen
602denominations and technical specifications of all coins intended for circulationStückelung und technische Merkmale aller für den Umlauf bestimmten Münzen
603issue of banknotesAusgabe von Banknoten
604to impose fines or periodic penalty payments on undertakingsUnternehmen mit Geldbussen oder Zwangsgeldern belegen
605formal agreement on an exchange-rate system for the ECUförmliche Vereinbarung über ein Wechselkurssystem für die ECU
606President of the Executive BoardPräsident des Direktoriums
607person of recognised standing and professional experience in monetary or banking mattersaus dem Kreis der in Währungs- oder Bankfragen anerkannten und erfahrenen Persönlichkeit
608Council of the EMIRat des EWI
609President of the EMIPräsident des EWI
610co-ordination of the monetary policies of the Member StatesKoordinierung der Geldpolitiken der Mitgliedstaaten
611rules and practices governing the collection, compilation and distribution of statisticsBestimmungen und Gepflogenheiten auf dem Gebiet der Erhebung, Zusammenstellung und Weitergabe statistischer Daten
612ECU banknoteEcu-Banknote
613conduct of monetary policyDurchführung der Währungspolitik
614normal fluctuation marginnormale Bandbreite
615long-term interest-rate levelNiveau der langfristigen Zinssätze
616conversion rates at which the currencies shall be irrevocably fixedUmrechnungskurse, auf die die Währungen unwiderruflich festgelegt werden
617to abrogate a derogationeine Ausnahmeregelung aufheben
618reporting commitmentBerichtspflicht
619existing practices regarding the issue and design of banknotesGepflogenheiten bei der Ausgabe und der Gestaltung von Banknoten
620marketable instrumentbörsengängiges Wertpapier
621other instruments of monetary controlsonstige geldpolitische Instrumente
622the national central banks shall be the sole subscribers to and holders of the capital of the ECBdie nationalen Zentralbanken sind alleinige Zeichner und Inhaber der Kapitals der EZB
623assets earmarkederfasste Vermögenswerte
624the EMI shall be entitled to hold and manage foreign-exchange reserves as an agent for and at the request of national central banksdas EWI ist befugt, auf Ersuchen nationaler Zentralbanken als deren Agent Währungsreserven zu halten und zu verwalten
625claims and liabilities arising from the very short-term financing mechanism and the short-term monetary support mechanismForderungen und Verbindlichkeiten aufgrund des Systems der sehr kurzfristigen Finanzierung und des Systems des kurzfristigen Währungsbeistands
626CFP francCFP-Franc
627African Financial CommunityAfrikanische Finanzgemeinschaft
628agrimonetary arrangementsagromonetäre Regelung
629ECU clearing and settlement systemECU-Verrechnungs- und Saldenausgleichssystem
630DKKdänische Krone
631Deutsche MarkDEM
632commodity derivativesvom Warenhandel abgeleitete Instrumente
633settlement riskAbwicklungsrisiko
634fixed currencyfeste Währung
635floating currencyfloatende Währung
636XEUECU-ISO-Code
637nomenclature of capital movementsNomenklatur für den Kapitalverkehr
638domestic money marketinländischer Geldmarkt
639colouredverfärbt
640EC Mint Directors Working GroupArbeitsgruppe der Direktoren der Münzanstalten der EG
641CFA francCFA-Franc
642ATSösterreichischer Schilling
643private consumption deflatorPreisdeflator/Deflator des privaten Verbrauchs
644Subcommittee on Monetary AffairsUnterausschuss Währung
645imbalancesUngleichgewichte
646lock-up lendinglangfristiger Kredit
647remote access to an IFTSFernzugang zu einem Interbank-Überweisungssystem
648Basle-Nyborg AgreementBasel-Nyborg-Abkommen
649IFTSInterbank-Überweisungssystem
650fixed rate tenderFestsatztender
651variable rate tenderTender mit variablem Zinssatz
652settlement agentVerrechnungsstelle
653French francfranzösischer Franc
654Concertation GroupKonzertationsgruppe
655Monitoring GroupMonitoring-Gruppe
656intervention at the limitsIntervention am Interventionspunkt
657intra-marginal interventionintramarginale Intervention
658large-value paymentsGrossbetragszahlungen
659direct participants (access) in IFTSDirektteilnehmer an Interbank-Überweisungssystemen
660liquidity sharing agreementLiquiditätsaufteilungsregel
661loss sharing rule, loss sharing agreementHaftungsverbund
662Zero-hour clauseNull-Uhr-Klausel
663Green Paper on the practical arrangements for the introduction of the single currencyGrünbuch über die praktischen Fragen des Übergangs zur einheitlichen Währung
664liquidity riskLiquiditätsrisiko
665critical masskritische Masse
666EMSEWS
667tender procedureTenderverfahren
668reference scenarioReferenzszenario
669cyclically-adjusted deficitkonjunkturbereinigtes Haushaltsdefizit
670CCRzentrales Kreditregister
671DVPL/Z
672NSSNettoausgleichssystem
673RTGSBruttoabwicklungssystem in Echtzeit
674FTSSystem zum Transfer von Geldbeträgen
675euro areaEuro-Gebiet
676to counteract market pressuresden Marktspannungen begegnen
677Working Group EUROArbeitsgruppe EURO
678special interest-bearing loanverzinsliches Sonderdarlehen
679non-euro-area-currenciesnicht dem Euro-Währungsgebiet angehörende Währungen
680non-euro-area NCBsnationale Zentralbanken der nicht am Euro-Währungsgebiet teilnehmenden Mitgliedstaaten
681remote accessFernzugang
682credit card fraudKreditkartenbetrug
683centCent
684monetary liabilitiesmonetäre Verbindlichkeiten
685euro unitEuro-Einheit
686budgetary convergenceKonvergenz im Bereich der öffentlichen Finanzen
687real exchange rate misalignmentreale Wechselkursverzerrungen
688budgetary positionHaushaltslage
689denomination of a legal instrumentWährungsbezeichnung eines Rechtsinstruments
690excessive nominal exchange rate fluctuationsübermäßige Schwankungen der nominalen Wechselkurse
691nominal exchange rate mechanismein an nominalen Wechselkursen ausgerichtetes System
692non-euro area Member Statenicht dem Euro-Währungsgebiet angehörender Mitgliedstaat
693significant misalignmentspürbare Kursverzerrung
694standard fluctuation bandStandardbandbreite
695standard wide bandweitgefasste Standardbandbreite
696foreign exchange interventionDevisenmarktintervention
697standard wide marginInterventionspunkte der weitgefassten Standardbandbreite
698intervention arrangementsInterventionsregelung
699monetary policy operationsgeld- und währungspolitische Massnahmen
700new tradeable public debtneue handelbare Schuldtitel der öffentlichen Hand
701redenomination of the outstanding debt in the euro unitausstehende Schuldtitel auf die Euro-Einheit umstellen
702IIPAuslandsvermögensstatus
703closer linkengere Anbindung
704closer exchange-rate linkengere Wechselkursanbindung
705narrower fluctuation bandschmalere Bandbreite
706exchange-rate arrangementWechselkursanbindung
707interest rate measureZinsmaßnahme
708severe recessionschwere Rezession
709adoption of the euroEinführung des Euro
710continuity of contractsKontinuität von Verträgen
711financial position of general governmentFinanzlage des Staates
712growth of money supplyGeldmengenausweitung
713book-entry system(System der) Girosammelverwahrung
714currency boardfeste Anbindung an eine Ankerwährung
715compensating controlsEigenkontrollen
716euroEuro
717sustainability of exchange rate relationsTragfähigkeit der Wechselkursrelationen
718deficit reductionDefizitabbau
719rules for roundingRundungsregeln
720electronic purseelektronische Geldbörse
721arbitrageArbitrage
722allocationAllokation
723prepaid SIM cardGuthabenkarte
724e-moneyE-Geld
725tolaTola
726RTbefristete Transaktion
727non-transferable assetnicht übertragbarer Vermögenswert
728bilateral procedurebilaterale Geschäfte (pl.)
729international CSDinternationale Wertpapierverwahrstelle
730chainingVerkettung
731final transferendgültige Übertragung
732final settlementendgültige Erfüllung
733legal riskrechtliches Risiko
734end-of-day gross settlement systemTagesschluss-Bruttoabwicklungssystem
735capital riskKapitalverlustrisiko
736guarantee modelGarantiemodell
737DVP linkL/Z-Verbindung
738nominal effective exchange ratenominaler effektiver Wechselkurs
739one-off measureeinmalige Massnahme
740bilateral exchange ratesbilaterale Wechselkurse
741narrow bandenge Bandbreite
742exchange rate turbulenceWechselkursturbulenz
743accumulated debt stocksaufgelaufene Schulden
744settlement positionAbrechnungsposition
745common eligibility criteriaeinheitliche Zulassungskriterien
746intraday liquidityInnertagesliquidität
747multilateral net positionmultilaterale Nettoposition
748PPP exchange rateKaufkraftparität
749short-term interest rate differentials against Germanykurzfristige Zinsdifferenzen gegenüber Deutschland
750GRDGRD
751ESPESP
752import price inflationAnstieg der Importpreise
753fixed exchange rate systemSystem fester Wechselkurse
754primary gapPrimärlücke
755bilateral divergenceAbweichung von den bilateralen Leitkursen
756private ecuprivate ECU
757substitutes for moneyGeldsubstitute
758interbank liquidityGeldmarktliquidität
759monetary frameworkgeldpolitische Strategie
760Irish poundirisches Pfund
761Italian liraitalienische Lira
762Portuguese escudoportugiesischer Escudo
763Finnish markkaFinnmark
764Swedish kronaschwedische Krone
765overnight market interest rateTagesgeldsatz
766euro banknoteEuro-Banknote
767truncatedverkürzt
768non-cash formbargeldlos
769remote participantFernzugangsteilnehmer
770cross-border money transfergrenzüberschreitender Zahlungsverkehr
771retail paymentMassenzahlung
772network moneyNetzgeld
773gross settlement systemBruttoabwicklungssystem
774uninvested cash balancenicht angelegte Barguthaben
775transactions balancesTransaktionskasse
776fixed-term advances rateZinssatz für Vorschüsse
777reserve currencyAnlagewährung
778pooling of the currencyVergemeinschaftung der Währung
779deepening of the single marketVertiefung des Binnenmarktes
780sustainable debt trendTragfähigkeit des Schuldentrends
781inflation convergenceKonvergenz der Inflationsraten
782retrenchmentHaushaltseinsparungen (pl.)
783debt service burdenSchuldendienstlast
784allocated gold accountGoldeinzelverwahrungskonto
785unallocated gold accountGoldsammelverwahrungskonto
786fixed interest rate instrumentFestzinsinstrument
787monetary lawWährungsrecht
788national currency unitnationale Währungseinheit
789inverse rate derived from the conversion ratevom Umrechnungskurs abgeleiteter inverser Kurs
790REERrealer effektiver Wechselkurs
791issue of euro coinsAusgabe der Euro-Münzen
792Community coinage systemMünzsystem der Gemeinschaft
793to move to a new coinage systemUmstellung auf ein neues Münzsystem
794Spanish flowerSpanische Blume
795cyclically adjustedkonjunkturbereinigt
796President of the ECBPräsident der EZB
797M3weit gefasstes Geldmengenaggregat
798CACFAZ
799recognised exchangeanerkannte Börse
800budget deficit ratioDefizitquote
801ELMIE-Geld-Institut
802intervention mechanismInterventionsmechanismus
803medium-term loanmittelfristiger Kredit
804borrowing interest rateHabenzinsen
805pricing structurePreisgefüge
806credit marketKreditmarkt
807net inflows of capitalNettokapitalimport
808liabilities to non-residentsAuslandsverbindlichkeiten
809public paperamtliches Wertzeichen
810stock market yieldBörsenrenditen
811share price indexAktienkursindex, Aktienpreisindex
812issue for general subscriptionöffentliches Angebot
813structural indicatorStrukturindikator
814suspect moneyRegistriergeld
815central government expenditureStaatsausgaben
816introduction of the euroBeginn des Bargeldumlaufs des Euro
817loro accountLorokonto
818unfunded pension planumlagefinanziertes Altersversorgungssystem
819harmonised long-term interest rateharmonisierter langfristiger Zinssatz
820large-value paymentGrossbetragszahlung
821link between securities settlement systemsVerbindung zwischen Wertpapierabrechnungssystemen
822measure with a temporary effectMassnahme mit zeitlich begrenzter Wirkung
823one-off effectone-off-Effekt
824self-reversing effectself-reversing-Effekt
825net capital expenditureNettokapitalausgaben
826call clausePari-Rückkaufs-Klausel
827frontloadingVorabausstattung
828single passportEinmalzulassung
829MEUROMillionen EUR
830acceptance of the euroAkzeptanz des Euro
831euro central rateEuro-Leitkurs
832M1eng gefasstes Geldmengenaggregat
833reference value for monetary growthReferenzwert für das Geldmengenwachstum
834convergence reportKonvergenzbericht
835counterfeiting of the euroFälschung des Euro
836CNACMAZ
837National Counterfeit CentreNationales Zentrum für Fälschungsbekämpfung
838CCDFalschgeld-Datenbank
839Guideline of the European Central BankLeitlinie der Europäischen Zentralbank
840escalation procedureVerfahren für die Behandlung eskalierender Probleme, Eskalationsverfahren
841NACNAZ
842real convergencereale Konvergenz
843subfrontloadingVorverteilung, Vorabausstattung
844seriesSeriennummer
845note numberlaufende Nummer
846Cash Changeover CommitteeCashCo
847BEuroMilliarden EUR
848electronic money instrumentelektronische Geldbörse
849competitive devaluationAbwertungswettlauf
850m-paymentM-Zahlung
851liability of general governmentVerbindlichkeit des Sektors Staat
852M2M2
853maturity bucketLaufzeitkategorie
854Agreement of 13 March 1979 between the central banks of the Member States of the European Economic Community laying down the operating procedures for the European Monetary SystemAbkommen vom 13.März 1979 zwischen den Zentralbanken der Mitgliedstaaten der Europäischen Wirtschaftsgemeinschaft über die Funktionsweise des Europäischen Währungssystem
855common currencygemeinsame Währung
856FRSFederal Reserve System
857inflationInflation
858floating interest ratevariabler Zinssatz
859foreign currencyDevisen
860benchmark rateBardevisenkurs
861capital controlBeschränkungen des Kapitalverkehrs
862inter-bank marketBankenmarkt
863disinflationDisinflation
864deflationDeflation
865price stabilityGeldwertstabilität
866base moneyZentralbankgeld
867equivalent of the EUA in a Community currencyGegenwert der ERE in einer Gemeinschaftswaehrung
868denominationNennwert
869mint directorsMünzdirektoren
870instrument of monetary policyInstrument der Geld-und Währungspolitik
871credit easingKrediterleichterung
872corporate credit cardFirmenkreditkarte
873short-term notekurzfristiger Finanztitel
874direct inflation targetingdirektes Inflationsziel
875correspondent central bankKorrespondenz-Zentralbank
876arbitration of exchangeWechselarbitrage
877economic and monetary policyWirtschafts-und Währungspolitik
878transfer of foreign-reserve assets to the ECBÜbertragung von Währungsreserven auf die EZB
879single monetary policyeinheitliche Währungspolitik
880credit cardKreditkarte
881debit cardDebetkarte
882multiplier effectMultiplikatoreffekt
883private label cardKundenkreditkarte
884CMFBAusschuss für die Wahrungs-,Finanz-und Zahlungsbilanzstatistiken
885nominal convergencemonetäre Konvergenz
886credit card readerKreditkartenleser
887FRBföderale Reservenbank
888instalmentRatenzahlung
889incomeErtrag
890bullion coinGoldmünze
891deductionsAbzüge
892PINPIN
893counterpartGegenposten
894FOMCOffenmarktausschuss
895trade weighted indexgewichteter Handelsindex
89611am callBargeldmarktzins
897M3liquide Verbindlichkeiten
898loss of purchasing powerKaufkraftverlust
899Werner planWerner-Bericht
900Euro exchange rateEuro-Wechselkurs
901forintForint
902zlotyPLN
903TLTL
904currency exchangesWährungsumrechnungen
905correction of the excessive deficitBehebung des übermässigen Defizits
906budget surveillanceHaushaltsüberwachung
907PSPZahlungsdienstleister
908ALaggregierte Liquidität
909trillionBillion
910quadrillionBilliarde
911quintillionTrillion
912sextillionTrilliarde
913acquirerAcquirer
914QEmonetäre Lockerung
915SDD schemeeuropaweites SEPA-Lastschriftverfahren
916specific prepaid instrumentInstrument mit bestimmtem Verwendungszweck
917general-purpose instrumentInstrument zur allgemeinen Verwendung
918single-purpose prepaid cardvorausbezahlte einfunktionale Karte
919non-cash instrumentbargeldloses Zahlungsinstrument
920EFSFEFSF
921European SemesterEuropäisches Semester
922Directive 2009/110/EC of the European Parliament and of the Council of 16 September 2009 on the taking up, pursuit and prudential supervision of the business of electronic money institutions amending Directives 2005/60/EC and 2006/48/EC and repealing Directive 2000/46/ECE-Geld-Richtlinie
923internet-based accessinternetbasierter Zugang
924Harmonised ConditionsHarmonisierte Bedingungen
925liquidity transferLiquiditätsübertragung
926admit to trading on a trading venuezum Handel an einem Handelsplatz zulassen
927marking of short ordersKennzeichnung von Leerverkaufsordern
928capacity opinionRechtsfähigkeitsgutachten
929AGSJahreswachstumsbericht
930inflation expectationInflationserwartung
931MROHRG
932central bank interventionZentralbankintervention
933economic surveillancewirtschaftspolitische Überwachung
934financial inter-linkagefinanzielle Verflechtung
935macro-surveillance frameworkRahmen für die Überwachung der Wirtschaftspolitik
936exchange rate misalignmentVerzerrung der realen Wechselkurse
937currency crisisWährungskrise
938PCCLPCCL
939ECCLECCL
940precautionary programmevorsorgliches Programm
941partial protection certificateTeilausfall-Versicherungszertifikat
942partial risk protectionTeilabsicherung für Staatsanleihen
943FFAVereinbarung über eine Finanzhilfefazilität
944ECCL+ECCL+-Fazilität
945ESBPFEuropean Sovereign Bond Protection Facility
946A Blueprint for a deep and genuine Economic and Monetary UnionKonzept für eine vertiefte und echte Wirtschafts- und Währungsunion
947precautionary credit linevorsorgliche Kreditlinie
948currency warWährungskrieg
949base currencyBasiswährung
950outright rateOutright-Terminkurs
951Rules for the organisation of the proceedings of the Euro SummitsRegeln für die Organisation der Arbeiten des Euro-Gipfels
952financial fragmentationFinanzmarktfragmentierung
953at parzu gleichen Kursen (gehandelt werden)
954SEPA CouncilSEPA-Rat
955merchantHändler
956PSPPPSPP
957steeringLenkung
958issuing of payment instrumentsAusgabe von Zahlungsinstrumenten
959Completing Europe’s Economic and Monetary UnionBericht der fünf Präsidenten
960national productivity boardnationaler Ausschuss für Produktivität

 

 

 

SIGN IN

Forgot Password

X