load-page

Terminology English – German 1016 European construction of 10 EUROPEAN UNION Part 5

Home/Blog/Terminology English – German 1016 European construction of 10 EUROPEAN UNION Part 5
Terminology English - German 2836 social protection

Inter Active Terminology of Europe

Terms English – German 1016 European construction of 10 EUROPEAN UNION Part 5

Domain: 10 EUROPEAN UNION

Subdomain: 1016 European construction

  No.

  English US

 German DE

4000law relating to aliensAusländerrecht
4001Central Register of ForeignersAZR
4002disbursement rateAuszahlungsquote
4003paying agentbeauftragte Zahlstelle
4004conditional loanbedingtes Darlehen
4005acts discharging guarantorsBefreiung der Bürgen
4006beneficiary countrybegünstigtes Land
4007support costsbegleitende Hilfe
4008predictable investment climateberechenbares Investitionsklima
4009mineral productsBergbauerzeugnisse
4010adjustment of charges to existing quotasBerichtigung der Anrechnungen auf die bestehenden Kontingente
4011special payment arrangementsbesondere Zahlungsvereinbarungen
4012special tariff treatmentbesondere Zollregelung
4013waste managementAbfallbehandlung
4014Agreement for the Establishment of the Indo-Pacific Fisheries CouncilÜbereinkommen über die Errichtung eines Fischereirates für den Indischen Ozean und den Pazifik
4015powers vested in the officerdem Anweisungsbefugten übertragene Befugnisse
4016to ensure that competition shall not be distortedden Wettbewerb vor Verfälschungen schützen
4017destabilising effectdestabilisierendee Einfluss
4018foreign exchangeDevisen
4019exchange transactionsDevisengeschäfte
4020technical assistance is phased outdie technische Hilfe wird schrittweise abgebaut
4021dumped productDumpingware
4022law enforcementRechtsdurchsetzung
4023integrityEhrenhaftigkeit
4024expeditious experts’ study to diagnose the production capacityEilgutachten zur Diagnose der Produktionskapazität
4025import licensing regimesEinfuhrlizenzregelungen
4026onlending bodyeingeschaltete Einrichtung
4027standard formStandardvordruck
4028Terms of Reference of the International Nickel Study GroupMandat der Internationalen Studiengruppe für Nickel
4029user of the technical assistanceEmpfänger der technischen Hilfe
4030energy busEnergiebus
4031development projectsEntwicklungsvorhaben
4032withdrawal symptomsEntzugserscheinungen
4033Golden TriangleGoldenes Dreieck
4034remission of penalties for delayErlass von Vertragsstrafen
4035general government net borrowingFinanzierungsdefizit des Gesamtstaates
4036financing proposalFinanzierungsvorschlag
4037financial protocolFinanzprotokoll
4038financing of running costsFolgehilfe
4039remission of debtsForderungsnachlass
4040previous historyfrühere Erfahrungen
4041cargo handlingFrachtumschlag
4042amount made availablefreigegebener Betrag
4043arable farmingFreilandkultur
4044Convention concerning Safety and Health in ConstructionÜbereinkommen über den Arbeitsschutz im Bauwesen
4045European Plan to combat drugsEuropäischer Drogenbekämpfungsplan
4046Aliens and Borders Departmentportugiesische Ausländer- und Grenzbehörde
4047common servicesgemeinsame Dienstleistungseinrichtungen
4048conditions governing entryEinreisebedingungen
4049arrangement of payment proceduresGestaltung der Zahlungsverfahren
4050home countryHeimatland
4051medium-term financial assistance mechanismSystem des mittelfristigen finanziellen Beistands
4052territories which enjoy full internal self-governmentHoheitsgebiete mit voller innerer Selbstregierung
4053adventBetriebsbeginn (2)
4054to clear for home use(Waren) zum freien Verkehr abfertigen
4055finance through an intermediaryindirekte Hilfen
4056industrial promotion bodiesIndustrieförderungseinrichtungen (1)
4057industrial cooperationindustrielle Zusammenarbeit
4058integral industriesIndustrien mit integrierender Funktion
4059infiltrationInfiltrierung
4060information mediaInformationsträger
4061at the rate of one fifth per yearin jährlichen Raten von einem Fünftel
4062European Convention on the Compensation of Victims of Violent CrimesEuropäisches Übereinkommen über die Entschädigung für Opfer von Gewalttaten
4063by instalmentsin Teilsendungen
4064international development financeinternationale Entwicklungsfinanzierung
4065international climateinternationale Rahmenbedingungen
4066inter-regional cooperationZusammenarbeit zwischen verschiedenen Regionen (2)
4067capital projectInvestitionen, Investitionsvorhaben
4068physical inventoryErfassung des realen Bestands
4069trade in precursorsHandel mit Drogengrundstoffen
4070markingKennzeichen
4071material identificationKennzeichnung des Materials
4072basic rural small- and medium-scale and labour-intensive industrieskleine und mittlere arbeitsintensive Grundindustrien auf dem Lande
4073small-scale industry in rural areasKleingewerbe in ländlichen Gebieten
4074Cooperation AgreementAbkommen über Zusammenarbeit
4075food processingLebensmittelverarbeitung
4076distribution networkVermarktungsweg
4077act of terrorismTerrorakt
4078uninterrupted residenceununterbrochener Aufenthalt
4079naturalisationEinbürgerung
4080internal Community bordersBinnengrenzen der EG
4081Committee on BananasAKP-Ausschuss “Bananen”
4082credit operationsKreditgeschäft, Aktivgeschäft
4083criterion of past performanceKriterium früherer Ausfuhrmengen
4084rural communityLandbevölkerung
4085agricultural resourceslandwirtschaftliche Ressourcen
4086agricultural water schemeslandwirtschaftliche Wasserbauvorhaben
4087transitDurchreise
4088temporary-stay visaVisum für den vorübergehenden Aufenthalt
4089terrorist organisationterroristische Vereinigung
4090double transit visaVisum für die zweimalige Durchreise
4091consular visaKonsularvisum
4092national identity cardnationaler Personalausweis
4093licensing feesLizenzgebühren
4094internal and external market opportunitiesMöglichkeiten auf den Binnen- und Aussenmärkten
4095free market principlesmarktwirtschaftliche Organisationsprinzipien
4096to add the approvalSichtvermerk erteilen
4097financial and technical cooperation schemeMassnahmen der finanziellen und technischen Zusammenarbeit
4098obligation to be declaredMeldepflicht
4099deportation orderGebietssperre
4100ministerial ConferenceMinisterkonferenz
4101characteristics of forgeryFälschungsmerkmale
4102fraudulently issuederschlichen
4103food aidNahrungsmittelhilfe
4104food productionNahrungsmittelproduktion
4105net borrowingNettofinanzierungsbedarf
4106permanent inventorylaufendes Bestandsverzeichnis
4107performance (of contracts) through public works departmentsAusführung in staatlicher Regie
4108standardisation bodyNormenausschuss
4109quasi-capitalQuasi-Kapital
4110returneeRückkehrer
4111framework decisionRahmenbeschluss
4112counter-narcoticsDrogenbekämpfung
4113regional groupingregionaler Zusammenschluss
4114itinerary of the voyageReiseweg
4115raw hides and skinsrohe Häute
4116penaltySanktion
4117umpire(1) Schiedsrichterobmann
4118debt burdenSchuldenlast
4119sectoral policysektorbezogene Politik
4120security arrangementsGeheimschutzvorkehrungen
4121special treatmentSonderregelung
4122spectrophotometrySpektrophotometrie
4123mechanism for very short-term financingSystem der sehr kurzfristigen Finanzierung
4124population studiespopulationsstudien
4125scrutiny of eligibility of projectsPrüfung der Zulässigkeit der Vorhaben (1)
4126percentage ruleProzentregel (1)
4127promoting companyTrägergesellschaft
4128traditional trade flowstraditionelle Handelsströme
4129handlingUmschlag
4130conversion of loans into grantsUmwandlung von Darlehen in Zuschüsse
4131Case before the Court of JusticeRechtssache vor dem Gerichtshof
4132CREST OpinionStellungnahme des CREST
4133Legal Service opinionGutachten des Juristischen Dienstes
4134Addition to the list of “A” items for … meeting of the CouncilErgänzung der Liste der A-Punkte
4135List of Resolutions and OpinionsListe der Entschliessungen und Stellungnahmen
4136very urgent (telex)eilt sehr
4137Note forAufzeichnung für
4138file noteAktenvermerk
4139Note from the PresidencyAufzeichnung des Vorsitzes
4140memodienstliche Mitteilung
4141Addendum … to provisional agendaAddendum … zur vorläufigen Tagesordnung
4142provisional agendavorläufige Tagesordnung
4143valid visagültiges Visum
4144draft minutesEntwurf eines Protokolls
4145Draft reportEntwurf eines Berichts
4146reportBericht
4147Supplementary reportZusatzbericht
4148Summary reportKurzbericht
4149Forwarding of textsÜbermittlung von Texten
4150outcome of proceedingsBeratungsergebnisse
4151memorandumMemorandum
4152production or manufacture of drugsGewinnung oder Herstellung von Suchtstoffen
4153Protocol for Limiting and Regulating the Cultivation of the Poppy Plant, the Production of, International and Wholesale Trade in, and Use of OpiumProtokoll über die Beschränkung und Regelung des Anbaues der Mohnpflanze, der Erzeugung von Opium, des internationalen Handels und Grosshandels mit Opium und seiner Verwendung
4154Protocol Bringing under International Control Drugs outside the Scope of the Convention of 13 July 1931 for Limiting the Manufacture and Regulating the Distribution of Narcotic Drugs, as amended by the Protocol signed at Lake Success on 11 December 1946Protokoll zur internationalen Überwachung von Stoffen, die von dem Abkommen vom 13. Juli 1931 zur Beschränkung der Herstellung und zur Regelung der Verteilung der Betäubungsmittel, geändert durch das am 11. Dezember 1946 in Lake Success unterzeichnete Protokoll, nicht erfasst werden
4155supporting actionUnterstützungsmassnahme
4156opiate officinal preparationsoffizinelle opiumhaltige Zubereitungen
4157after-careNachsorge
4158supplementary reportZusatzbericht
4159reference periodVergleichszeitraum
4160transport and communicationVerkehrs- und Kommunikationswesen
4161production marketedvermarktete Produktion
4162obligations inherent in the concept of a public serviceVerpflichtungen, die unter den Begriff des öffentlichen Dienstes fallen
4163dispatchVersand
4164Extract from draft summary recordAuszug aus dem Entwurf einer Kurzniederschrift
4165Extract from the draft minutes of the … meeting of the CouncilAuszug aus dem Entwurf eines Protokolls über die … Tagung des Rates
4166NoteAnmerkungen (Pl.)
4167Draft letterEntwurf eines Schreibens
4168establishment of a single marketVerwirklichung eines Gemeinschaftsmarktes
4169resources managed by the bankvon der Bank verwaltete Mittel
4170temporary residencevorübergehender Aufenthalt
4171preparation for the launching of a projectVorbereitung der Inbetriebnahme eines Vorhabens
4172regulationVorschriften (pl.)
4173precautionary measureErhaltungsmaßnahme
4174detection deviceDetektionsgerät
4175monetary authoritiesWährungsbehörden
4176water engineering micro-projectsWasserbau-Kleinstvorhaben
4177village water engineeringWasserbauvorhaben in den Dörfern
4178policing of inland waterwaysWasserschutzpolizei
4179reintegration into the country of originWiedereingliederung in das Herkunftsland
4180customs supervisionzollamtliche Überwachung
4181European citizenshipeuropäische Bürgerschaft
4182OCOK
4183access to employmentZugang zur Beschäftigung
4184amounts replenishedzur Auffüllung gezahlte Beträge
4185joint actiongemeinsame Maßnahme
4186summary reportKurzbericht
4187contract priceZuschlagspreis
4188competent international forumszuständige internationale Gremien
4189inter-State bodyzwischenstaatliche Einrichtung
4190boardingEinsteigen
4191economic and monetary policyWirtschafts- und Währungspolitik
4192Terms of Reference of the International Copper Study GroupSatzung der Internationalen Studiengruppe für Kupfer
4193ACP-EEC Ministerial Negotiating ConferenceAKP-EWG-Verhandlungskonferenz auf Ministerebene
4194General CommitteeAllgemeine Kommission des Europäisch-Arabischen Dialogs
4195principle of “land for peace”Grundsatz “Land gegen Frieden”
4196Rules of Arbitration of the International Chamber of Commercedie Vergleichs- und Schiedsordnung der Internationalen Handelskammer
4197investment protectionInvestitionsschutz
4198implementation proceduresDurchführungsverfahren
4199matter of common interestAngelegenheit von gemeinsamem Interesse
4200regional formations of the technical groupTechnische Arbeitsgruppe (regionale Teilgruppen)
4201industrial trainingAusbildung in Industrieberufen
4202products originating in Member StatesUrsprungswaren der Mitgliedstaaten
4203date of issueAusgabedatum
4204sponsoring Statebefürwortender Staat
4205decision to transferBeschluss über einen Transfer
4206distinctive features of transportBesonderheiten des Verkehrs
4207Committee of ThreeDreier-Ausschuss, Ausschuss der drei Weisen
4208to be residenteinen Geschäftssitz haben
4209accession of the German Democratic Republic to the Federal Republic of GermanyBeitritt der Deutschen Demokratischen Republik zur Bundesrepublik Deutschland
4210untied loanungebundenes Darlehen
4211to increase tradeden Handelsverkehr steigern
4212services providederbrachte Leistungen
4213statement for the minutesErklärung für das Protokoll
4214CISASDÜ
4215internal borderBinnengrenze
4216external borderAußengrenze
4217Negotiating Group III : Free circulation of personsVerhandlungsgruppe III: Freizügigkeit
4218BCPGrenzübergangsstelle
4219border checkGrenzkontrolle
4220European CouncilEuropäischer Rat
4221Kirchberg European CentreEuropazentrum Kirchberg
4222financing decisionFinanzierungsbeschluss
4223bureau de changeWechselstube
4224United Nations Good Offices MissionGute-Dienste-Mission
4225Executive Board of the Centre for the Development of IndustryVerwaltungsrat des Zentrums für industrielle Entwicklung
4226new European architecturedie neue europäische Architektur
4227mutual assistancegegenseitiger Beistand
4228joint minutesgemeinsame Niederschrift
4229joint bodygemischte Einrichtung
4230general provisions of ACP-EEC cooperationGrundlagen der AKP-EWG-Zusammenarbeit
4231acts of the institutionsHandlungen der Organe
4232auxiliary organHilfsorgan
4233territoryHoheitsgebiet
4234to record in the minutesins Protokoll aufnehmen
4235HLNGVerhandlungsgruppe auf hoher Ebene
4236minimum reservesMindestreserven
4237incidental servicesNebenleistungen
4238Joint Committee of the ACP-EEC Consultative AssemblyParitätischer Ausschuss
4239sudden crisis in the balance of paymentsplötzliche Zahlungsbilanzkrise
4240repayment of internal taxationRückvergütung für inländische Abgaben
4241peripheral stateRandstaat
4242erasureRasur
4243instrument of ratificationRatifikationsurkunde
4244such provisions as are a matter for regulation or administrative actionRechtsverordnungen und Verwaltungsvorschriften
4245regional agenciesregionale Einrichtungen
4246indicative timetableRichtzeitplan
4247film coolingSchleierkühlung
4248education and trainingAllgemein- und Berufsbildung, allgemeine und berufliche Bildung, Bildung und Ausbildung
4249Exchequer foreign borrowingstaatliche Kreditaufnahme im Ausland
4250national territoryStaatsgebiet
4251effective and continuous linktatsächliche und dauerhafte Verbindung
4252transfer agreementTransferabkommen
4253opt-outAusnahmeregelung
4254Liaison Committee for the Promotion of Tropical Fruits and Off-season Vegetables Exported from ACP StatesVerbindungsausschuss der Erzeuger, Exporteure, Importeure, Beförderungsunternehmen und Vertriebshändler für tropisches Obst und Gemüse
4255retaliation measureGegenmaßnahme
4256security regulationsVerschlusssachen-Verordnung
4257depositary governmentVerwahrregierung
4258commercial invoiceHandelsrechnung
4259warningWarnhinweis
4260advance timetableZeitfolge
4261comprehensive approachumfassender Ansatz
4262applicant StateBewerberland
4263RPODEntladebahnhof
4264non-self-governing territoriesHoheitsgebiete ohne Selbstregierung
4265water controlRegulierung der Wasserzufuhr und -ableitung
4266allocation of resourcesFaktoreinsatz
4267upgradingRevalorisierung
4268facilitation networkSchleusernetz
4269property, funds and assetsVermögensgegenstände, Liegenschaften und Guthaben
4270administrative agreementVerwaltungsabkommen, Verwaltungsübereinkommen
4271termination of the agreementAusserkraftsetzen des Übereinkommens
4272within the meaning of Article Xim Sinne des Artikels x
4273Ministerial Conference on Migration from Eastern and Central EuropeMinisterkonferenz über Wanderungsbewegungen von Personen aus Ländern Mittel- und Osteuropas
4274ICPRIKSR
4275registered luggageaufgegebenes Reisegepäck
4276arrest warrantHaftbefehl
4277half-tonegerastertes Bild
4278travel documents to which a visa may be affixedsichtvermerksfähiges Reisedokument
4279common list of aliens for whom an alert has been issued for the purposes of refusing entrygemeinsame Liste von zur Einreiseverweigerung ausgeschriebenen Drittausländern
4280Contracting Party issuing the alertausschreibende Vertragspartei
4281cross-border surveillancegrenzüberschreitende Observation
4282officer carrying out the surveillanceobservierender Beamter
4283pursuing officernacheilender Beamter
4284arm normally used as a weapon of warKriegsschusswaffe
4285single-shot short firearm with rimfire percussionkurze Einzellader-Feuerwaffe mit Randfeuerzündung
4286semi-automatic long firearmhalbautomatische Lang-Feuerwaffe
4287arm for signalling purposesSignalwaffe
4288alarmSchreckschusswaffe
4289discreet checkverdeckte Kontrolle
4290specific checkgezielte Kontrolle
4291Committee on Negotiations with HungaryAusschuss für die Verhandlungen mit Ungarn
4292European pillareuropäischer Pfeiler
4293international communityVölkergemeinschaft
4294uniform visaeinheitlicher Sichtvermerk
4295CFSPGASP
4296long-stay visaVisum für den längerfristigen Aufenthalt
4297to move freelysich frei bewegen
4298rehabilitationRehabilitation
4299detectionErfassung, Detektion, Erkennung, Entdeckung, Ortung
4300FMOPfreier Personenverkehr
4301police cooperationpolizeiliche Zusammenarbeit
4302Convention on Climate ChangeKlimarahmenkonvention der Vereinten Nationen
4303transfer of the enforcement of criminal judgmentsÜbertragung der Vollstreckung von Strafurteilen
4304Schengen Drugs GroupSchengen-Arbeitsgruppe “Betäubungsmittel”
4305possession of firearmsBesitz von Feuerwaffen
4306SPASonderprogramm der Gemeinschaft zugunsten bestimmter armer und hochverschuldeter Länder in Afrika südlich der Sahara
4307donors’ conferenceBeitragsankündigungskonferenz
4308the groundwork for the new structure of Europedas Fundament für die neue europäische Architektur
4309crypto equipmentKodierungsgerät
4310CCEELänder in Mittel- und Osteuropa
4311ASEAN Post-Ministerial ConferenceKonferenz im Anschluss an das ASEAN-Ministertreffen
4312HELIOS IIAktionsprogramm der Gemeinschaft zugunsten der Behinderten
4313penalty interestStrafzinsen
4314foreign-exchange assetsDevisen
4315Convention respecting the Rights and Duties of Neutral Powers in Maritime WarAbkommen betreffend die Rechte und Pflichten der Neutralen im Falle eines Seekriegs
4316JCCGemischter Kooperationsausschuss
4317IEPGIEPG
4318PCGPCG
4319dissimilar conditionsunterschiedliche Bedingungen
4320His ExcellencyIhre Exzellenz (IE)
4321ground nut oilErdnussöl
4322with due regard for the provisions of the Treatyunter Beachtung der Vorschriften des Vertrags
4323border crossingGrenzübergang
4324import arrangementEinfuhrbestimmungen
4325conditions under which non-resident carriers may operate transport services within a Member StateBedingungen für die Zulassung von Verkehrsunternehmern zum Verkehr innerhalb eines Mitgliedstaates, in dem sie nicht ansässig sind
4326self-sufficiency in foodNahrungsmittelselbstversorgung
4327reference valuesReferenzwert
4328advisory bodyberatende Einrichtung
4329adverse opinion of the Court of Justiceablehnendes Gutachten des Gerichtshofs
4330interdependenceVerflechtung
4331compliance with the letters rogatoryErledigung des Rechtshilfeersuchens
4332Convention on Environmental Impact Assessment in a Transboundary ContextEspoo-Übereinkommen
4333work at piece ratesnach Akkord bezahlte Arbeit
4334work at time ratesnach Zeit bezahlte Arbeit
4335People’s Bureau of the Great Socialist People’s Libyan Arab JamahiriyaVolksbüro der Sozialistischen Libysch-Arabischen Volks-Dschamahirija
4336exchange of informationInformationsaustausch
4337humanitarian reasonshumanitäre Gründe
4338criminal offenceStraftat
4339Central Authorityzentrale Behörde
4340cryptographic deviceVerschlüsselungsgerät
4341economic governmentWirtschaftsregierung
4342overall guaranteeGesamtgarantie
4343Fourth ACP-EC Convention4. Abkommen von Lomé
4344AFCENTAFCENT
4345commercial disputeHandelskonflikt
4346Second ACP-EEC Convention, signed at Lomé on 31 October 1979Zweites AKP-EWG-Abkommen, unterzeichnet am 31. Oktober 1979 Lomé
4347outline replySchema einer Antwort, Antwortschema
4348revised outline replyüberarbeitetes Antwortschema
4349Subcommittee on Trade CooperationUnterausschuss für handelspolitische Zusammenarbeit
4350MashreqMaschrik
4351cost-plus contractAuftrag zu Selbstkostenerstattungspreisen
4352the launching of mining and energy projectsInbetriebnahme von Bergbau- und Energievorhaben
4353preferential accessZugang zu Vorzugsbedingungen
4354emergency measureSofortmassnahme
4355pre-accession aidHeranführungshilfe
4356year of applicationAnwendungsjahr
4357EICEG-Beratungsstelle für Unternehmen
4358Convention on the Protection and Use of Transboundary Watercourses and International LakesÜbereinkommen zum Schutz und zur Nutzung grenzüberschreitender Wasserläufe und internationaler Seen
4359INSGINSG
4360Textile Management CommitteeVerwaltungsausschuss für Textilien
4361prohibition of discriminationBenachteiligungsverbot
4362handloom fabricshandgewebte Stoffe
4363Joint Management CommitteeParitätischer Direktionsausschuss
4364requested Contracting Partyersuchte Vertragspartei
4365punishable offencestrafbare Handlung
4366service weaponDienstwaffe
4367apprehendanhalten
4368right to apprehendFesthalterecht
4369Q carZivilstreifenwagen
4370Association CouncilAssoziationsrat
4371INRursprüngliches Verhandlungsrecht, Erstverhandlungsrecht
4372EISEIS
4373absolute povertyabsolute Armut
4374EISIES
4375VRAExportbeschränkungsabkommen
4376responsibilities of carriersVerpflichtungen der Verkehrsunternehmen
4377Commodities CommitteeGrundstoffausschuss
4378descriptionBeschreibung
4379all destinations derogationAusnahmeregelung für die Ausfuhren nach jedweder Bestimmung
4380security thread bearing micro printSicherheitsfaden mit Mikrodruck
4381IHFFCIHFFC
4382European Convention on the Service Abroad of Documents relating to Administrative MattersEuropäisches Übereinkommen über die Zustellung von Schriftstücken in Verwaltungssachen im Ausland
4383nuclear crimeNuklearkriminalität
4384spontaneous assistanceUnterstützung ohne vorangehenden Antrag
4385to assign a participationeine Beteiligung veräussern
4386SCENTSCENT
4387European Central Criminal Investigation Office (Europol)Europäische Kriminalpolizeiliche Zentralstelle (EUROPOL)
4388non-participating Mediterranean Statesnicht teilnehmende Mittelmeerstaaten
4389EDIUEDIU
4390MINURSOMINURSO
4391Conference of FinanciersKonferenz der Geldgeber
4392emergency humanitarian aidhumanitäre Soforthilfe
4393Advisory Council of the Committee on Industrial CooperationBeirat des Ausschusses für industrielle Zusammenarbeit
4394any other business itemPunkt unter “Sonstiges”
4395non-Protocol Mediterranean financial Regulationprotokollunabhängige Finanzregelung für die Mittelmeerländer
4396ICOMInternationaler Museumsrat
4397statutes (of the Centre for the Development of Industry)Satzung (des Zentrums für industrielle Entwicklung)
4398ECSC TreatyEGKS-Vertrag
4399Rome TreatyAEUV
4400EAEC TreatyEAG-Vertrag
4401Merger TreatyFusionsvertrag
4402Treaty amending Certain Budgetary Provisions of the Treaties establishing the European Communities and of the Treaty establishing a Single Council and a Single Commission of the European CommunitiesVertrag zur Änderung bestimmter Haushaltsvorschriften
4403refraining from the threat or use of forceNichtanwendung oder Nichtandrohung von Gewalt
4404good-neighbourly relationsgutnachbarliche Beziehungen
4405air or naval componentKomponenten der See- oder Luftstreitkräfte
4406development-finance undertakingsFinanzunternehmen für Entwicklung
4407Financial Regulation applicable to development finance cooperation under the Fourth ACP-EEC ConventionFinanzregelung für die Zusammenarbeit bei der Entwicklungsfinanzierung im Rahmen des Vierten AKP-EWG-Abkommens
4408irrevocably fixed exchange ratesunwiderruflich festgelegte Wechselkurse
4409CCEMEL
4410Judicial CodeGerichtsgesetzbuch
4411CTQGZK
4412restricted lists of service contractsbegrenzte Listen für Dienstleistungsaufträge
4413other holdersonstiger Halter
4414decision-making bodies of the ECBBeschlussorgane der EZB
4415presumption of innocenceUnschuldsvermutung
4416TADTransatlantische Erklärung
4417criminal records departmentsErkennungsdienst
4418CATFArbeitsgruppe “Drogengrundstoffe”
4419CSOAHB
4420sustainable and non-inflationary growthbeständiges, nichtinflationäres Wachstum
4421flowering of the cultures of the Member StatesEntfaltung des Kulturlebens in den Mitgliedstaaten
4422national and regional diversitynationale und regionale Vielfalt
4423concerted and convergent actionskonvergierendes Handeln
4424the unity, consistency and effectiveness of action by the Unioneinheitliches, kohärentes und wirksames Vorgehen der Union
4425cooperation in the fields of justice and home affairsZusammenarbeit in den Bereichen der Justiz und Inneres
4426monetary incomemonetäre Einkunfte
4427to facilitate vocational integration and reintegration into the labour marketErleichterung der beruflichen Eingliederung und Wiedereingliederung in den Arbeitsmarkt
4428IFAIFA
4429deliveryVerkündung der Entscheidung
4430the procedural law of a Member Statedas Verfahrensrecht eines Mitgliedstaats
4431unlawful actHandlung, die das Recht verletzt
4432Protocol to the Convention on Long-range Transboundary Air Pollution concerning the Control of Emissions of Volatile Organic Compounds or their Transboundary FluxesProtokoll zu dem Übereinkommen über weiträumige grenzüberschreitende Luftverunreinigung betreffend die Bekämpfung von Emissionen flüchtiger organischer Verbindungen oder ihres grenzüberschreitenden Flusses
4433blocking statuteblockierende Gesetze
4434Internal Agreement on the measures and procedures required for implementation of the fourth ACP-EEC ConventionInternes Abkommen über die zur Durchführung des Vierten AKP-EWG-Abkommens zu treffenden Massnahmen und die dabei anzuwendenden Verfahren
4435EDPWEuropäische Woche der Suchtprävention
4436ISMZwischentagung
4437Interstate Economic CommitteeZwischenstaatliches Wirtschaftskomitee
4438PFISchutz der finanziellen Interessen der EU
4439CIREACIREA
4440Alpine ConventionAlpenkonvention
4441The co-Presidents of the Joint Assemblydie Ko-Präsidenten der Paritätischen Versammlung
4442ECETECET
4443inside front coverDeckelinnenseite vorn
4444Chief State SolicitorChief State Solicitor, Solicitor for the Attorney General
4445TNFNuklearstreitkräfte in und für Europa
4446transfer decisionTransferbeschluss
4447European Energy CharterEnergiechartaerklärung
4448TIPSInternationales Technologisches Pilotsystem
4449ITTCInternationaler Tropenholzrat
4450common list of dual use goodsGemeinsame Liste der Güter mit doppeltem Verwendungszweck
4451Union financial assistancefinanzieller Beistand der Gemeinschaft
4452regional and local communitiesregionale und lokale Gebietskörperschaften
4453unauthorised immigration, residence and workillegale Einwanderung, illegaler Aufenthalt und illegale Arbeit
4454fraud on an international scaleBetrügereien im internationalen Massstab
4455stock of government debtHöhe des öffentlichen Schuldenstands
4456Article K.4 CommitteeAusschuss des Artikels K.4
4457maximum permissible ratios between those reserves and their basishöchstzulässige Relationen zwischen diesen Mindestreserven und ihrer Basis
4458allocation of net profits and losses of the ECBVerteilung de Nettogewinne un Verluste der EZB
4459clearing and payment systemsVerrechnungs- und Zahlungssysteme
4460system of open and competitive marketsSystem offener und wettbewerbsorientierter Märkte
4461current exchange ratesjeweiliger Wechselkurs
4462foreign-exchange working balancesArbeitsguthaben in Fremdwährungen
4463intermediate monetary objectivegeldpolitische Zwischenziele
4464supply of reservesBereitstellung von Zentralbankgeld
4465operational efficiency of the management of the ECBEffizienz der Verwaltung der EZB
4466the shares of the national central banks in the suscribed capital of the ECB may not be transferred, pledged or attacheddie Anteile der nationalen Zentralbanken am gezeichnenten Kapital der EZB können nicht übertragen, verpfändet oder gepfändet werden
4467deposit liabilities to credit institutionsVerbindlichkeiten aus Einlagen der Kreditinstitute
4468paid-up shares in the capital of the ECBeingezahlte Anteile am Kapital der EZB
4469clearing and settlement of the balancesVerrechnung und Ausgleich der Salden
4470general reserve fundallgemeiner Reservefonds
4471liability regimeHaftungsregelung
4472total gross debt at nominal valueBrutto-Gesamtschuldenstand zum Nominalwert
4473convergence criteriaKonvergenzkriterien
4474government budgetary positionFinanzlage der öffentlichen Hand
4475average nominal long-term interest ratedurchschnittlicher langfristiger Nominalzinssatz
4476interest-free credit facilityzinsfreie Kreditfazilität
4477ways and means facilityWays and Means-Fazilität
4478Protocol on the Economic and Social Committee and the Committee of the RegionsProtokoll (Nr. 16) betreffend den Wirtschafts- und Sozialausschuss und den Ausschuss der Regionen
4479mixed competencegemeinsame Zuständigkeit
4480Vienna GroupWiener Gruppe
4481charitable associationVerbände der Wohlfahrtspflege
4482ORGebiet in äußerster Randlage
4483EMCDDABeobachtungsstelle
4484OFPamtlicher Pass
4485EU TreatyEUV
4486PCWEU-Planungsstab
4487coordination of investigations and search operationsKoordinierung von Ermittlungen und Fahndungen
4488examining magistrateUntersuchungsrichter
4489AbkhaziaAbchasien
4490IRASHF
4491N.SISN.SIS
4492C.SISC.SIS
4493Sirene BureauSIRENE
4494Management Board of the European Monitoring Centre for Drugs and Drug AddictionVerwaltungsrat der Europäischen Beobachtungsstelle für Drogen und Drogensucht
4495Agreement on the European Economic AreaAbkommen über den Europäischen Wirtschaftsraum
4496logistic supportlogistische Unterstützung
4497apex loanAPEX-Darlehen
4498intergovernmental cooperationRegierungszusammenarbeit
4499onlending of a loan to a final recipientWeitervergabe eines Darlehens an den Endbegünstigten
4500linen textureLeinenstruktur
4501PNNCSNNA
4502to achieve a stage in attaining freedom of establishment as regards a particular activityDurchführung einer Stufe der Niederlassungsfreiheit für eine bestimmte Tätigkeit
4503blankMuster-Vordruck
4504signature slipUnterschrift auf Papierträger
4505superimposed textsÜberschreibungen
4506offender (group) analysisTäteranalyse
4507specific profile analysisspezifische Profilanalyse
4508crime analysisKriminalitätsanalyse
4509general profile analysisallgemeine Profilanalyse
4510(crime control) method analysisAnalyse der Kriminalitätsbekämpfungsmethoden
4511crime pattern analysisKriminalitätsbildanalyse
4512case analysisFallanalyse
4513comparative case analysisvergleichende Fallanalyse
4514Treaty between the Kingdom of Belgium, the Federal Republic of Germany, the French Republic, the Italian Republic, the Grand Duchy of Luxembourg, the Kingdom of the Netherlands (Member States of the European Communities), the Kingdom of Denmark, Ireland, the Kingdom of Norway and the United Kingdom of Great Britain and Northern Ireland concerning the accession of the Kingdom of Denmark, Ireland, the Kingdom of Norway and the United Kingdom of Great Britain and Northern Ireland to the European Economic Community and to the European Atomic Energy CommunityVertrag zwischen dem Königreich Belgien, der Bundesrepublik Deutschland, der Französischen Republik, der Italienischen Republik, dem Grossherzogtum Luxemburg, dem Königreich der Niederlande (Mitgliedstaaten der Europäischen Gemeinschaften), dem Königreich Dänemark, Irland, dem Königreich Norwegen und dem Vereinigten Königreich Grossbritannien und Nordirland über den Beitritt des Königreichs Dänemark, Irlands, des Königreichs Norwegen und des Vereinigten Königreichs Grossbritannien und Nordirland zur Europäischen Wirtschaftsgemeinschaft und zur Europäischen Atomgemeinschaft
4515Treaty between the Kingdom of Belgium, the Kingdom of Denmark, the Federal Republic of Germany, the French Republic, Ireland, the Italian Republic, the Grand Duchy of Luxembourg, the Kingdom of the Netherlands, the United Kingdom of Great Britain and Northern Ireland (Member States of the European Communities) and the Hellenic Republic concerning the accession of the Hellenic Republic to the European Economic Community and to the European Atomic Energy CommunityVertrag zwischen dem Königreich Belgien, dem Königreich Dänemark, der Bundesrepublik Deutschland, der Französischen Republik, Irland, der Italienischen Republik, dem Grossherzogtum Luxemburg, dem Königreich der Niederlande, dem Vereinigten Königreich Grossbritannien und Nordirland (Mitgliedstaaten der Europäischen Gemeinschaften) und der Republik Griechenland über den Beitritt der Republik Griechenland zur Europäischen Wirtschaftsgemeinschaft und zur Europäischen Atomgemeinschaft
4516Treaty between the Kingdom of Belgium, the Kingdom of Denmark, the Federal Republic of Germany, the Hellenic Republic, the French Republic, Ireland, the Italian Republic, the Grand Duchy of Luxembourg, the Kingdom of the Netherlands, the United Kingdom of Great Britain and Northern Ireland (Member States of the European Communities) and the Kingdom of Spain and the Portuguese Republic concerning the accession of the Kingdom of Spain and the Portuguese Republic to the European Economic Community and to the European Atomic Energy CommunityVertrag zwischen dem Königreich Belgien, dem Königreich Dänemark, der Bundesrepublik Deutschland, der Griechischen Republik, der Französischen Republik, Irland, der Italienischen Republik, dem Grossherzogtum Luxemburg, dem Königreich der Niederlande, dem Vereinigten Königreich Grossbritannien und Nordirland (Mitgliedstaaten der Europäischen Gemeinschaften) und dem Königreich Spanien und der Portugiesischen Republik über den Beitritt des Königreichs Spanien und der Portugiesischen Republik zur Europäischen Wirtschaftsgemeinschaft und zur Europäischen Atomgemeinschaft
4517Protocol on Social PolicyProtokoll über die Sozialpolitik
4518Agreement on social policy concluded between the Member States of the European Community with the exception of the United Kingdom of Great Britain and Northern IrelandAbkommen zwischen den Mitgliedstaaten der Europäischen Gemeinschaft mit Ausnahme des Vereinigten Königreichs Groβbritannien und Nordirland über die Sozialpolitik
4519TACISProgramm TACIS
4520considerable technical hazardsgrosse technische Risiken
4521division of the European continentTeilung des europäischen Kontinents
4522an ever closer union among the peoples of Europeeine immer engere Union der Völker Europas
4523single institutional frameworkeinheitlicher institutioneller Rahmen
4524general political guidelinesallgemeine politische Zielvorstellungen
4525yearly written report on the progress achieved by the Unionalljährlicher schriftlicher Bericht über die Fortschritte der Union
4526constitutional traditions common to the Member Statesgemeinsame Verfassungsüberlieferungen der Mitgliedstaaten
4527convergence of economic performanceKonvergenz der Wirtschaftsleistungen
4528education and training of qualityqualitativ hochstehende allgemeine und berufliche Bildung
4529irrevocable fixing of exchange ratesunwiderrufliche Festlegung der Wechselkurse
4530single monetary policy and exchange-rate policyeinheitliche Geld- und Wechselkurspolitik
4531stable pricesstabile Preise
4532sound monetary conditionsgesunde Monetäre Rahmenbedingungen
4533sustainable balance of paymentsdauerhaft finanzierbare Zahlungsbilanz
4534to have the right to vote and to stand as a candidate at municipal electionsdas aktive und passive Wahlrecht bei Kommunalwahlen haben
4535adoption (by the Member States) in accordance with their respective constitutional requirementsAnnahme (durch die Mitgliedstaaten) gemäβ ihren verfassungsrechtlichen Vorschriften
4536capital and paymentsKapital und Zahlungsverkehr
4537restrictions on paymentBeschränkungen des Zahlungsverkehrs
4538a step back in Community lawein Rückschritt im Rahmen des Gemeinschaftsrechts
4539aid to promote culture and heritage conservationBeihilfen zur Förderung der Kultur und der Erhaltung des kulturellen Erbes
4540sudden influx of nationals from a third country into the Communityplötzlichen Zustrom von Staatsangehörigen dieses Landes in die Gemeinschaft
4541visa requirementVisumpflicht
4542uniform format for visaseinheitliche Visagestaltung
4543the maintenance of law and order and the safeguarding of internal security(für die) Aufrechterhaltung der öffentlichen Ordnung und den Schutz der inneren Sicherheit
4544satellite imagerySatellitenbild
4545sustained convergence of the economic performances of the Member Statesdauerhafte Konvergenz der Wirtschaftsleistungen der Mitgliedstaaten
4546overall assessmentGesamtbewertung
4547Community institutions or bodiesOrgane oder Einrichtungen der Gemeinschaft
4548other bodies governed by public law, or public undertakings of Member Statesandere öffentlich-rechtliche Körperschaften der Mitgliedstaaten
4549supply of reserves by central banksBereitstellung von Zentralbankgeld
4550private credit institutionprivates Kreditinstitut
4551mutual financial guarantees for the joint execution of a specific projectgegenseitigen finanziellen Garantien für die gemeinsame Durchführung eines bestimmten Vorhabens
4552to impose fines of an appropriate sizeGeldbussen in angemessener Höhe verhängen
4553denominations and technical specifications of all coins intended for circulationStückelung und technische Merkmale aller für den Umlauf bestimmten Münzen
4554issue of banknotesAusgabe von Banknoten
4555to impose fines or periodic penalty payments on undertakingsUnternehmen mit Geldbussen oder Zwangsgeldern belegen
4556formal agreement on an exchange-rate system for the ECUförmliche Vereinbarung über ein Wechselkurssystem für die ECU
4557arrangements for the negotiation and for the conclusion of agreements (concerning monetary or foreign-exchange regime matters)Modalitäten für die Aushandlung und den Abschluβ von Vereinbarungen (über) Währungsfragen oder Devisenregelungen
4558President of the Executive BoardPräsident des Direktoriums
4559Vice-President of the ECBVizepräsident der EZB
4560person of recognised standing and professional experience in monetary or banking mattersaus dem Kreis der in Währungs- oder Bankfragen anerkannten und erfahrenen Persönlichkeit
4561lasting convergence necessary for the achievement of economic and monetary unionfür die Verwirklichung der Wirtschafts- und Währungsunion notwendige dauerhafte Konvergenz
4562economic and monetary convergenceKonvergenz im Wirtschafts- und Währungsbereich
4563Council of the EMIRat des EWI
4564President of the EMIPräsident des EWI
4565Vice-President of the EMIVizepräsident des EWI
4566co-ordination of the monetary policies of the Member StatesKoordinierung der Geldpolitiken der Mitgliedstaaten
4567rules and practices governing the collection, compilation and distribution of statisticsBestimmungen und Gepflogenheiten auf dem Gebiet der Erhebung, Zusammenstellung und Weitergabe statistischer Daten
4568efficiency of cross-border paymentsEffizienz des grenzüberschreitenden Zahlungsverkehrs
4569ECU banknoteEcu-Banknote
4570conduct of monetary policyDurchführung der Währungspolitik
4571the Commission shall recommend to the Council the granting of mutual assistancedie Kommission empfiehlt dem Rat einen gegenseitigen Beistand
4572high degree of sustainable convergencehoher Grad an dauerhafter Konvergenz
4573government budgetary position without a deficit which is excessiveöffentliche Haushaltslage ohne übermässiges Defizit
4574normal fluctuation marginnormale Bandbreite
4575durability of convergence achieved by the Member StateDauerhaftigkeit der von dem Mitgliedstaat erreichten Konvergenz
4576long-term interest-rate levelNiveau der langfristigen Zinssätze
4577date for the beginning of the third stageZeitpunkt für den Beginn der dritten Stufe
4578Member State with a derogationMitgliedstaat, für den eine Ausnahmeregelung gilt
4579Member State without a derogationMitgliedstaat, für den keine Ausnahmeregelung gilt
4580conversion rates at which the currencies shall be irrevocably fixedUmrechnungskurse, auf die die Währungen unwiderruflich festgelegt werden
4581to abrogate a derogationeine Ausnahmeregelung aufheben
4582special committee appointed by the Councilvom Rat bestellter besonderer Ausschuss
4583disturbance to the functioning of the common marketdas Funktionieren des Gemeinsamen Marktes … stören
4584industrial changes and changes in production systemsindustrieller Wandlungsprozess und Veränderung der Produktionssysteme
4585quality educationqualitativ hochstehende Bildung
4586content of teachingLehrinhalte
4587organisation of education systemsGestaltung des Bildungssystems
4588teaching and dissemination of the languages of the Member StatesErlernen und Verbreitung der Sprachen der Mitgliedstaaten
4589mobility of students and teachersMobilität von Lernenden und Lehrenden
4590cooperation between educational establishmentsZusammenarbeit zwischen den Bildungseinrichtungen
4591youth exchanges and exchanges of socio-educational instructorsJugendaustausch und Austausch sozialpädagogischer Betreuer
4592mobility of instructors and traineesMobilität der Ausbilder und der in beruflicher Bildung befindlichen Personen
4593cooperation on training between educational or training establishments and firmsZusammenarbeit in Fragen der beruflichen Bildung zwischen Unterrichtsanstalten und Unternehmen
4594common cultural heritagegemeinsames kulturelles Erbe
4595conservation and safeguarding of cultural heritage of European significanceErhaltung und Schutz des kulturellen Erbes von europäischer Bedeutung
4596major health scourgesweitverbreitete schwerwiegende Krankheiten
4597Europartyeuropäische politische Partei
4598complaint from any citizen of the UnionBeschwerden von jedem Bürger der Union
4599vote of approval by the European ParliamentZustimmungsvotum des Europäischen Parlaments
4600amount of the lump sum or penalty paymentHöhe des Pauschalbetrags oder Zwangsgelds
4601the Court of Auditors shall carry out the auditder Rechnungshof nimmt die Rechnungsprüfung wahr
4602regulations, directives and decisions adopted jointly by the European Parliament and the Councildie Verordnungen, Richtlinien und Entscheidungen, die vom Europäischen Parlament und vom Rat gemeinsam angenommen werden
4603specific regional interestsspezifische regionale Interessen
4604fraud affecting the financial interests of the CommunityBetrügereien, die sich gegen die finanziellen Interessen der Gemeinschaft richten
4605agreement establishing a specific institutional framework by organising cooperation proceduresAbkommen, die durch Einführung Zusammenarbeitsverfahren einen besonderen institutionellen Rahmen schaft
4606agreement having important budgetary implications for the CommunityAbkommen mit erheblichen finanziellen Folgen für die Gemeinschaft
4607necessary urgent measureerforderliche Sofortmassnahme
4608systematic cooperation between Member States in the conduct of policyregelmässige Zusammenarbeit der Mitgliedstaaten bei der Führung ihrer Politik
4609important interests in commonwichtige gemeinsame Interessen
4610cohesive force in international relationskohärente Kraft in den internationalen Beziehungen
4611previous Member State to hold the Presidencyvorhergehenden Vorsitz
4612next Presidencyfolgender Vorsitz
4613principles of and general guidelines for the common foreign and security policyGrundsätze und allgemeinen Leitlinien der Gemeinsamen Aussen- und Sicherheitspolitik
4614asylum policyAsylpolitik
4615policy regarding nationals of third countriesPolitik gegenüber den Staatsangehörigen dritter Länder
4616judicial cooperation in civil law mattersJZZ
4617criminal judicial cooperationjustizielle Zusammenarbeit in Strafsachen
4618acquisition of second homesErwerb von Zweitwohnungen
4619appropriate provisions for enforcementgeeignete Vorkehrungen zur Durchsetzung
4620guidelines and decisions necessary to ensure the performance of the tasks entrusted to the ESCBLeitlinien
4621reporting commitmentBerichtspflicht
4622existing practices regarding the issue and design of banknotesGepflogenheiten bei der Ausgabe und der Gestaltung von Banknoten
4623other instruments of monetary controlsonstige geldpolitische Instrumente
4624operations with public entitiesGeschäfte mit öffentlichen Stellen
4625external operationsGeschäfte mit dritten Ländern und internationalen Organisationen
4626the national central banks shall be the sole subscribers to and holders of the capital of the ECBdie nationalen Zentralbanken sind alleinige Zeichner und Inhaber der Kapitals der EZB
4627capital shareKapitaleinteil
4628assets earmarkederfasste Vermögenswerte
4629the EMI shall be entitled to hold and manage foreign-exchange reserves as an agent for and at the request of national central banksdas EWI ist befugt, auf Ersuchen nationaler Zentralbanken als deren Agent Währungsreserven zu halten und zu verwalten
4630claims and liabilities arising from the very short-term financing mechanism and the short-term monetary support mechanismForderungen und Verbindlichkeiten aufgrund des Systems der sehr kurzfristigen Finanzierung und des Systems des kurzfristigen Währungsbeistands
4631CFP francCFP-Franc
4632right of associationKoalitionsrecht
4633common organisational structureGOS
4634European Security and Defence Academyeuropäische Akademie für Sicherheit und Verteidigung
4635double-hatting formulaFormel des “doppelten Hutes”
4636CSBürgergesellschaft
4637Lower Tier meeting of the Dublin GroupSitzung der Dublin-Gruppe auf nachgeordneter Ebene
4638Upper Tier meeting of the Dublin GroupSitzung der Dublin-Gruppe auf höherer Ebene
4639Agreement for international collaboration on the consequences of the Chernobyl accidentÜbereinkommen EURATOM/Republik Belarus/Russische Föderation/Ukraine über die internationale Zusammenarbeit bezüglich der Folgen des Unfalls von Tschernobyl
4640EurodacEurodac
4641policy areaPolitikbereich
4642BDLVerbindungsbüro
4643CCGCCG
4644mechanical paperholzhaltiges Papier
4645loan paperAktienpapier
4646hand-made paperBüttenpapier
4647laid antique papergeripptes Papier
4648additive colour synthesisadditive Farbmischung
4649subtractive colour synthesissubtraktive Farbmischung
4650holographyHolographie
4651imitation embossingStahlstichimitation
4652feederAnlegeapparat
4653backing-upWiderdruck
4654bond paperBondpapier
4655binding lineBuchstrasse
4656three-knife trimmerDreimesserautomat
4657ordinary passportgewöhnlicher Reisepass
4658SPPSonderpass
4659Agency for the Prohibition of Nuclear Weapons in Latin AmericaOPANAL
4660UNFICYPFriedenssicherungstruppe der Vereinten Nationen auf Zypern
4661Partnership AgreementPartnerschaftsabkommen
4662airliftLufttransport
4663Multi-annual Programme for the Promotion of Human Rights in Central AmericaMehrjähriges Programm zur Förderung der Menschenrechte in Zentralamerika
46641992 Helsinki ConventionHelsinki-Übereinkommen in seiner Fassung von 1992
4665status of full participantVollbeteiligung
4666EDUEDU
4667calenderkalandrieren
4668calenderKalander
4669hollanderHolländer
4670UV reactiveUV-reaktiv
4671iridescent planchetteirisierende Planchette
4672reagent planchetteReagenz-Planchette
4673erasing agentchemisches Rasurmittel
4674UV light sourceUV-LichtquelleF
4675light-sensitive materiallichtempfindliches Material
46763D picture (3-dimensional)3D-Bild (dreidimensionales Bild)
4677flip-flop hologramHologramm mit Kippeffekt
4678INCINC
4679half-toneHalbton
4680head marginKopfsteg
4681gutter marginBundsteg
4682tail marginFusssteg
4683intermediate marginZwischensteg
4684line structureLinienstruktur
4685electronic image processingelektronische Bildverarbeitung
4686updatingAktualisierung
4687imposition schemeAusschiessschema
4688challenge inspectionVerdachtsinspektion
4689screen lineRasterlineatur
4690bitmap imageBitmap-Bild
4691planographic printingFlachdruck
4692die cuttingAusstanzen
4693blind embossingBlindpressung
4694notchingZähnung
4695hand-setting processHandsatz
4696numbering deviceNummerierapparat
4697multi-colour pressMehrfarbenpresse
4698plate cylinderPlattenzylinder
4699metamerismMetamerie
4700thermal printerThermodrucker
4701colour printerFarbdrucker
4702Offshore ProtocolProtokoll zum Schutz des Mittelmeers vor Verschmutzung durch die Erforschung und Nutzung des Festlandsockels, des Meeresbodens und des Meeresuntergrunds
4703Extension ConferenceVerlängerungskonferenz
4704Mediterranean BasinMittelmeerraum
4705EAEuropa-Abkommen
4706ten-fingerprint formZehn-Fingerabdruckblatt
4707spectral responsespektrale Empfindlichkeit
4708CORClub of Rome
4709project team of EuropolEuropol-Aufbaustab
4710joint handbook for the application of the Dublin ConventionGemeinsamer Leitfaden für die Anwendung des Dubliner Übereinkommens
4711Compilation of texts on European practice with respect to asylumTextsammlung zur europäischen Asylpraxis
4712book-blockBuchblock
4713spineBuchrücken
4714covering materialÜberzugsmaterial
4715straight spinegerader Rücken
4716rounded spinerunder Rücken
4717spine designed with a joint (or ridge) down each sideRückenausführung mit Falz
4718bookletLage
4719trimmingDreimesserschnitt
4720gatheringZusammentragen
4721endsheet pastingVorsatzkleben
4722folding planFalzschema
4723processing planVerarbeitungsschema
4724CIDSEInternationale Arbeitsgemeinschaft für Entwicklung und Solidarität
4725check kitDetektionskit
4726Waldmann DocutestWaldmann-Dokutest
4727SAMsHilfsmissionen zur Durchsetzung der Sanktionen
4728Production Co-ordination CommitteeProduktionskoordinierungsausschuss
4729Convention for the Protection of the Marine Environment of the North-East AtlanticOSPAR
4730user’s guideBenutzerleitfaden
4731determining projectsAuswahl der Vorhaben
4732diplomatic visaDiplomatenvisum
4733EEA JPCGemeinsamer Parlamentarischer EWR-Ausschuss
4734Economic Forum(KSZE-)Wirtschaftsforum
4735to have jurisdiction in any disputefür alle Streitsachen zuständig sein
4736ECOMSABeobachtermission der Europäischen Gemeinschaft in Südafrika
4737hitFahndungserfolg
4738capacity buildingAusbau von Fähig- und Fertigkeiten
4739educational or vocational trainingSchul- oder Berufsausbildung
4740monitoring reportBeobachtungsbericht
4741An Agenda for PeaceAgenda für den Frieden
4742WSSDWeltgipfel für soziale Entwicklung
4743to change one’s place of residenceden Wohnort wechseln
4744Member State of originHeimatstaat
4745UNSCOMSonderkommission der Vereinten Nationen
4746STFSTF
4747live ammunitionGefechtsmunition
4748Convention on the Transboundary Effects of Industrial AccidentsÜbereinkommen über die grenzüberschreitenden Auswirkungen von Industrieunfällen
4749Third Pillardritte Säule
4750Common ManualGemeinsames Handbuch
4751CEFTACEFTA
4752facts complained ofzur Last gelegte Handlungen
4753co-sponsorsSchirmherrenländer
4754multilateral trackmultilaterale Friedensverhandlungen
4755Agreement on the Accession of the Portuguese Republic to the Convention implementing the Schengen Agreement of 14 June 1985 between the Governments of the States of the Benelux Economic Union, the Federal Republic of Germany and the French Republic on the gradual abolition of checks at their common borders signed at Schengen on 19 June 1990, to which the Italian Republic acceded by the Agreement signed at Paris on 27 November 1990Übereinkommen über den Beitritt der Portugiesischen Republik zu dem am 19. Juni 1990 in Schengen unterzeichneten Übereinkommen zur Durchführung des Übereinkommens von Schengen vom 14.Juni 1985 zwischen den Regierungen der Staaten der Benelux-Wirtschaftsunion, der Bundesrepublik Deutschland und der Französischen Republik betreffend den schrittweisen Abbau der Kontrollen an den gemeinsamen Grenzen, dem die Italienische Republik mit dem am 27.November 1990 in Paris unterzeichneten Übereinkommen beigetreten ist
4756Avicenne Initiative (Scientific and technological cooperation with Maghreb and the countries of the Mediterranean Basin)Initiative Avicenna (Wissenschaftliche und technologische Zusammenarbeit mit den Maghreb-Ländern und anderen Mittelmeerländern)
4757Pact on Stability in EuropePakt für Stabilität in Europa
4758maiden nameMädchenname
4759CEEMOE
4760COMRGV
4761CPCKVZ
4762Agreement on Cooperation and Customs Union between the European Economic Community and the Republic of San MarinoAbkommen über eine Zusammenarbeit und eine Zollunion zwischen der Europäischen Wirtschaftsgemeinschaft und der Republik San Marino
4763Declaration (No 17) on the right of access to informationErklärung (Nr. 17) zum Recht auf Zugang zu Informationen
4764PSSAbesonders empfindliches Meeresgebiet
4765Levant Drugs Working PartyGruppe “Drogen” (Östliche Mittelmeerländer)
4766classified informationVS
4767San José processSan-José-Prozess
4768licence shoppinglicence shopping
4769appeal procedureBerufungsverfahren
4770document in lieu of passportPassersatzdokument
4771provisional identity papersvorläufige Identitätsbescheinigung
4772black printSchwarzdrucktext
4773MED-INVESTMED-INVEST
4774MED-CAMPUSMED-CAMPUS
4775MED-URBSMED-URBS
4776recovery of the amount of the customs debtErhebung des Zollschuldbetrags
4777EAECEAEC
4778Commission on the Truth (in El Salvador)Wahrheitskommission
4779OLSAktion Überlebensbrücke Sudan
4780Committee of ACP AmbassadorsAKP-Botschafterausschuss
4781the European pillar of the Atlantic Allianceeuropäischer Pfeiler der Atlantischen Allianz
4782Standing Committee of the European Convention on Spectator Violence and Misbehaviour at Sports Events and in particular at Football MatchesStändiges Komitee des Europäischen Übereinkommens über Gewalttätigkeiten und Fehlverhalten von Zuschauern bei Sportveranstaltungen und insbesondere bei Fussballspielen
4783IPTIPT
4784image-archiving systemBildspeichersystem
4785JHAJI
4786ROEEinsatzregeln
4787provisional residence permitvorläufige Aufenthaltserlaubnis
4788drug precursorDrogenausgangsstoff
4789alternative developmentalternative Entwicklung
4790immigrants handled by (illegal immigration) networksGeschleuste
4791new cooperative security orderneue kooperative Sicherheitsordnung
4792compass roseWindrose
4793Steering Group IIILenkungsgruppe III
4794Steering Group ILenkungsgruppe I
4795serious crimeSchwerkriminalität
4796category of classificationGeheimhaltungsstufe
4797IMGIMG
4798EC Elections UnitEuropäischer Wahldienst
4799interception of telecommunicationsTKÜ
4800UNPASchutzzone der Vereinten Nationen
4801Joint Committeegemischter Ausschuss
4802principle of specialityGrundsatz der Spezialität
4803no objection procedureKein-Einwand-Verfahren
4804fiscal offencefiskalische strafbare Handlung
4805carrying out of sentencesStrafvollstreckung
4806racist and xenophobic actsrassistische und fremdenfeindliche Handlungen
4807multi-agency approachZusammenwirken mehrerer Stellen (“multi-agency-approach”)
4808IOCdas internationale organisierte Verbrechen
4809judicial contact pointjustizielle Kontaktstelle
4810the 1993 Ministerial GuidanceMinisterrichtlinie
4811CNADCNAD
4812EUEU
4813V-3Visegrader Troika
4814BSECBSEC
4815common actiongemeinsames Vorgehen
4816non-resident ambassadorauswärts residierender Botschafter
4817inaugural conferenceVorbereitungskonferenz
4818National Coordinators’ Group on DrugsGruppe der nationalen Koordinatoren für die Drogenbekämpfung
4819ENUnationale Europol-Stelle
4820request for intelligenceErkenntnisanfrage
4821Central UnitZentralstelle
4822NCISNCIS
4823convoying of humanitarian aidBeförderung der humanitären Hilfe
4824civZb
4825department responsible for issuing visasVisumstelle
4826NDIUNDIU
4827ELOELO
4828Act of AccessionAkte über die Bedingungen des Beitritts
4829data media controlDatenträgerkontrolle
4830input controlEingabekontrolle
4831user controlBenutzerkontrolle
4832data access controlZugangskontrolle
4833communication controlÜbermittlungskontrolle
4834equipment access controlZugangskontrolle
4835JSBGKI
4836criminal intelligence practiceIntelligence-Arbeit
4837financial investigationsFinanzermittlungen
4838forms of crimeErscheinungsformen der Kriminalität
4839investigation analysisErmittlungsanalyse
4840lines of enquiryErmittlungsansätze
4841start-up phaseAnlaufphase
4842provisional phaseÜbergangsphase
4843drug tourismDrogentourismus
4844PCAAbkommen über Partnerschaft und Zusammenarbeit
4845meeting of the European CouncilTagung des Europäischen Rates
4846non-authorised disclosureunbefugte Weitergabe
4847CSCE Working PartyGruppe “KSZE”
4848Charter TreatyECV
4849AHWGad-hoc-Arbeitsgruppe
4850procuringAusbeutung der Prostitution
4851encryption boxChiffriergerät
4852(assistant) caretaker co-ordinatorgeschäftsführender Koordinator
4853intelligence divisionAbteilung “Intelligence” (EUROPOL)
4854to adopt in the languages of the European UnionAnnahme in den Amtssprachen der Europäischen Union
4855caretaker coordinatorgeschäftsführender Koordinator
4856support division (Europol)Abteilung “Logistik” (EUROPOL)
4857fields of crimeDeliktsbereiche
4858EDU manualEDU-Handbuch
4859ELO-FormELO-Formblatt
4860DOCWGGruppe “Drogen und organisierte Kriminalität”
4861unauthorised accessunbefugter Zugriff
4862physical protection of data processing systemsphysischer Schutz der Datenverarbeitungssysteme
4863access control deviceZugangskontrollgerät
4864user-privilege conceptBerechtigungskonzept
4865encryption softwareVerschlüsselungssoftware
4866log fileProtokolldatei
4867personnel drivebenutzerspezifisches Laufwerk
4868world drivebereichsübergreifendes Laufwerk
4869Executive CommitteeExekutivausschuss
4870keep under observationobservieren
4871provide proof that [they are] acting in an official capacityihre amtliche Funktion nachweisen
4872to arrestfestnehmen
4873for questioningzum Zwecke der Vernehmung (festhalten)
4874Interview BoardAuswahlgremium
4875national channels of notificationnationale Meldewege
4876illegal immigration flowsillegale Zuwanderungsströme
4877pre-convention phaseVorphase des Übereinkommens
4878operational and strategic analysisoperative und strategische Analyse
4879analysis sectionAnalyseabteilung
4880strategic intelligence reportBericht über strategische Erkenntnisse
4881strategic intelligence bulletinInformationsschrift über strategische Erkenntnisse
4882crime statisticsKriminalstatistiken
4883investigative teamErmittlungsgruppe
4884inferential statisticsanalytische Statistiken
4885descriptive statisticsbeschreibende Statistiken
4886encrypted faxKrypto-Fax
4887EDU Supervisory boardEDU-Aufsichtsstelle
4888serious forms of international crimeschwerwiegende Formen der internationalen Kriminalität
4889strategic intelligencestrategische Auswertung
4890national operation resourcesauf nationaler Ebene für operative Aufgaben vorhandene Ressourcen
4891technical and forensic police methodskriminaltechnische und kriminalwissenschaftliche Methoden
4892investigative proceduresErmittlungsmethoden
4893mission statementAufgabenbereich
4894Europol’s management teamLeitungsgremium der Europol-Drogenstelle
4895cross-border cooperationgrenzüberschreitende Zusammenarbeit
4896security correspondentGeheimschutzbeauftragter
4897MEDHUMMEDHUM
4898products obtained by hunting or fishingJagdbeute und Fischfänge
4899Working Party on Extension of the Brussels ConventionGruppe “Erweiterung des Brüsseler Übereinkommens”
4900Working Party on ExtraditionGruppe “Auslieferung”
4901External Frontiers Working PartyGruppe “Aussengrenzen”
4902False Documents Working PartyGruppe “Gefälschte Dokumente”
4903Working Party on Simplification of Document TransmissionGruppe “Vereinfachung der Übermittlung von Schriftstücken”
4904photo substitutionLichtbildaustausch
4905General Situation Report in respect of drug trafficking in the European CommunityBericht über die allgemeine Lage beim illegalen Drogenhandel in der Gemeinschaft
4906UNMOGIPMilitärbeobachtergruppe der Vereinten Nationen in Indien und Pakistan
4907UV printingUV-Aufdruck
4908Council Decision on public access to Council documentsBeschluss des Rates über den Zugang der Öffentlichkeit zu Ratsdokumenten
4909double criminalitybeiderseitige Strafbarkeit
4910Piranha maritime operationAktion PIRANHA
4911PWP(Permanent Working Party)
4912PWGTPWGT
4913stickerEtikettenaufkleber
4914temporary permission to residebefristete Zulassung zum Aufenthalt
4915checks to detect and prevent threatsfahndungstechnische Überprüfung sowie die Abwehr von Gefahren
4916liaison officerVerbindungsbeamter
4917period of validityGültigkeitsdauer
4918conditions governing the issue of visas at bordersVoraussetzungen für die Sichtvermerkserteilung an der Grenze
4919extension of the visaVerlängerung des Sichtvermerks
4920to transit through the territories of the other Contracting Partiesdurch das Hoheitsgebiet der anderen Vertragsparteien reisen
4921validgültig
4922immediate departuresofortige Ausreise
4923expelledabgeschoben
4924to apprehendaufgreifen
4925practical arrangementspraktische Modalitäten
4926Management BoardVerwaltungsrat von Europol
4927classification levelGeheimhaltungsgrad
4928accessory extraditionakzessorische Auslieferung
4929European cumulationeuropäische Kumulierung
4930Ministerial Agreement on the establishment of the Europol Drugs UnitMinistervereinbarung über die Einrichtung der Europol-Drogeneinheit
4931residesich aufhalten
4932applicant Contracting Partyantragstellende Vertragspartei
4933identity papersPersonaldokumente
4934STABEX SubcommitteeUnterausschuss “STABEX”
4935Convention on the Law Applicable to Succession to the Estates of Deceased PersonsÜbereinkommen über das auf die Rechtsnachfolge von Todes wegen anzuwendende Recht
4936spurious passportPseudoprodukt
4937Agreement on the Accession of the Hellenic Republic to the Convention implementing the Schengen Agreement of 14 June 1985 between the Governments of the States of the Benelux Economic Union, the Federal Republic of Germany and the French Republic on the gradual abolition of checks at their common borders signed at Schengen on 19 June 1990, to which the Italian Republic acceded by the Agreement signed at Paris on 27 November 1990, and to which the Kingdom of Spain and the Hellenic Republic acceded by the Agreements signed at Bonn on 25 June 1991Übereinkommen über den Beitritt der Griechischen Republik zu dem am 19. Juni 1990 in Schengen unterzeichneten Übereinkommen zur Durchführung des Übereinkommens von Schengen vom 14. Juni 1985 zwischen den Regierungen der Staaten der Benelux-Wirtschaftsunion, der Bundesrepublik Deutschland und der Franösischen Republik betreffend den schrittweisen Abbau der Kontrollen an den gemeinsamen Grenzen
4938Working Party on Disqualification from DrivingGruppe “Entzug der Fahrerlaubnis”
4939interception of communicationsÜberwachung der Kommunikation
4940customs fraudZollbetrug
4941surveillance on air and sea trafficÜberwachung des Luft- und Seeverkehrs
4942contact magistrateKontaktrichter bzw. Kontaktstaatsanwalt
4943Staff UnitStabstelle
4944Drugs Case fileFDR
4945TSFNTSFN
4946to draw up conventionsÜbereinkommen erstellen
4947interception orderÜberwachungsanordnung
4948national civil protection servicesnationale Katastrophenschutzdienste
494924-hour contact pointständig besetzte Anlaufstelle
4950(attribution of) security classification levels (to documents)Einstufung von Dokumenten in Geheimhaltungsgrade
4951to comply with a security classificationals Verschlusssache behandeln
4952COREU Terminal Equipment SystemCORTESY
4953CFSP Communications Working PartyGruppe “GASP-Kommunikation”
4954operational analystAnalytiker für operative Analyse
4955strategic analystAnalytiker für strategische Analyse
4956offence charged, fact complained ofAnschuldigung
4957in the actfrische Tat
4958civilian clothesZivilkleidung
4959clemency proceedingsGnadensache
4960criminal courtStrafgericht
4961releaseEntlassung
4962REDWGArbeitsgruppe über regionale wirtschaftliche Entwicklung
4963back upSicherungskopie
4964data storageAufbewahrung von Daten
4965Central Credit CommitteeZentraler Kreditausschuss (ZKA)
4966Financial police deskReferat für Finanzermittlungen
4967searchDurchsuchung
4968criminal grouping(Straf)tätergruppierung
4969judicial recordJustizdokumentation
4970request that the enforcement be taken overErsuchen um Übernahme der Vollstreckung
4971magazine of firearmsMagazin von Feuerwaffen
4972chamber of firearmsPatronenlager von Feuerwaffen
4973metal-case cartridgePatrone mit Metallhülse
4974automated search procedureAbruf im automatisierten Verfahren
4975alert on persons and propertyAusschreibungen, die der Suche nach Personen und Sachen dienen
4976ECEG
4977Rules of Procedure of the EEA CouncilGeschäftsordnung des EWR-Rates
4978World Ministerial Conference on Organised Transnational CrimeWeltministerkonferenz zur Organisierten grenzüberschreitenden Kriminalität
4979PCStändiger Rat
4980EUROCORPSEurokorps
4981the European Union’s Advance PartyVorausdelegation der Europäischen Union
4982Administration of Justice ActRechtspflegegesetz
4983operational headsLeiter der Ermittlungsreferate
4984ETDRückkehrausweis
4985Assistant Co-ordinatorStellvertretender Koordinator
4986hard dataharte Daten
4987soft dataweiche Daten
4988AHLCAHLC
4989COMSEC authorityCOMSEC-Behörde
4990COMSECCOMSEC
4991Instructions for dealing with classified materialVSA
4992refusal of residence permitAufenthaltsverbot
4993association to commit offencesBande
4994UN Standard minimum rules for the administration of juvenile justice (The Beijing Rules)Beijing-Regeln
4995reflection groupReflexionsgruppe
4996Committee of Experts on the Treatment of Young Adult OffendersEuroparatsfachausschuss, der sich mit der Behandlung heranwachsender Straftäter befasst
4997fraudulent acquisitionErschleichung
4998stick-in visaVisummarke
4999document crimeUrkundenkriminalität

 

SIGN IN

Forgot Password

X