load-page

Terminology English – German 1231 international law

Home/Blog/Terminology English – German 1231 international law
Terminology English - German 2836 social protection

Inter Active Terminology of Europe

Terms English – German 1231 international law

Domain: 12 LAW

Subdomain: 1016 European construction

 No.

 English US

 German DE

1handcuffsHandschellen
2forgery of money and means of paymentGeld- und Zahlungsmittelfälschung
3grievous bodily injuryschwere Körperverletzung
4motor vehicle crimeKfz-Kriminalität
5criminationAnklageerhebung
6kickbackKick-back
7commercial piracykommerzielle Piraterie
8sexual harassmentsexuelle Belästigung
9illegal drugillegale Droge
10capital punishmentTodesstrafe
11operatorWirtschaftsbeteiligter
12drug dealerDrogenhändler
13drug-dependent offenderRauschgiftdelinquent
14trafficking in womenFrauenhandel
15amnestyAmnestie
16situational child sex abuserGelegenheitstäter
17preferential child sex abuserKinderschänder mit Präferenzen
18child sex abuserKinderschänder
19child prostitutionKinderprostitution
20child pornographyKinderpornographie
21child traffickingKinderhandel
22electric-shock batonElektroschlagstock
23fraudulent actbetrügerische Handlung
24facilitatorSchleuser
25value confiscationEinziehung des Wertersatzes
26scheduled substanceerfasster Stoff
27organised robberyDiebstahl in organisierter Form
28organ removalOrganentnahme
29probable causehinreichender Verdacht
30criminal damageSachbeschädigung
31forced pregnancyerzwungene Schwangerschaft
32APGAPG
33HR.IDOCUntersuchungs- und Disziplinaramt
34domestic slaverySklaverei im Haushalt
35avoidanceSteuerumgehung
36evasionHinterziehung
37backhanderSchmiergeld
38counterfeitTotalfälschung
39double jeopardyVerbot der doppelten Strafverfolgung
40software piracySoftwarediebstahl
41informantInformant
42computer crimeComputerstraftat
43International Conference on Narcotic Drugsinternationale Suchtstoffkonferenz
44potassium permanganateKaliumpermanganat
45conspiracyMittäterschaft
46Convention on Psychotropic Substances, 1971Übereinkommen von 1971 über psychotrope Stoffe
47mutual assistance in criminal mattersRechtshilfe in Strafsachen
48criminogenickriminogen
49embezzlementUnterschlagung, Veruntreuung
50activity of criminal investigationeine justizpolizeiliche Tätigkeit
51fraudulent conversionmissbräuchliche Verwendung von Geldern
52criminal prosecutionStrafverfolgung
53CNDSuchtstoffkommission
54carousel fraudKarussellbetrug
55copyright piracyunerlaubte Herstellung urheberrechtlich geschützter Waren
56offenceZuwiderhandlung
57ethyl etherEthylether
58sexual harassment at work (at the workplace)sexuelle Belästigung am Arbeitsplatz
59fineGeldbuße
60acetic anhydrideEssigsäureanhydrid
61audiovisual piracyBild-und Tonpiraterie
62Protocol amending the Single Convention on Narcotic Drugs, 1961Protokoll zur Änderung des Einheits-Übereinkommen von 1961 über Suchtstoffe
63Additional Protocol to the European Convention on Mutual Assistance in Criminal MattersZusatzprotokoll zum Europäischen Übereinkommen über die Rechtshilfe in Strafsachen
64monoecious hempmonözischer Hanf
65European Convention on the Suppression of TerrorismEuropäisches Übereinkommen zur Bekämpfung des Terrorismus
66European Convention on Mutual Assistance in Criminal MattersEuRHÜbk
67European Convention on ExtraditionEuropäisches Auslieferungsübereinkommen
68European Convention on the Supervision of Conditionally Sentenced or Conditionally Released OffendersEuropäisches Übereinkommen über die Überwachung bedingt verurteilter oder bedingt entlassener Personen
69European Convention on the Transfer of Proceedings in Criminal MattersEuropäisches Übereinkommen über die Übertragung der Strafverfolgung
70European Convention on the International Validity of Criminal JudgmentsEuropäisches Übereinkommen über die internationale Geltung von Strafurteilen
71Convention on the Transfer of Sentenced PersonsÜbereinkommen über die Überstellung verurteilter Personen
72insider offenceInsiderdelikt
73CRS(1)System zur Notifizierung der Gläubigerländer
74principle of legalityGrundsatz der Gesetzesbindung
75inside dealingInsider-Geschäfte
76illegal immigrant smugglingSchlepperei
77extraditionAuslieferung
78CDPCCDPC
79Co-ordinators’ Group on Free Movement of PersonsGruppe der Koordinatoren “Freizügigkeit”
80drug misuserBetäubungsmittelkonsument
81Trevi 1992 GroupGruppe “TREVI 1992”
82DNDAbteilung Suchtstoffe (der UNO)
83TREVI GroupTREVI-Kooperation
84miscarriage of justiceFehlurteil
85Criminal Investigation DepartmentKriminalpolizei
86legal classificationrechtliche Qualifikation
87NCPNationale Kontaktstelle
88INCBINCB
89courierSchlepper
90fantasy documentPhantasiedokument
91illegal entryillegale Einreise
92intra-community monitoringinnergemeinschaftliche Überwachung
93abrasionAbrieb
94methadoneMethadon
95Recommendation No. R (87) 15 of the Committee of Ministers to Member States Regulating the Use of Personal Data in the Police SectorEmpfehlung Nr. R(87)15 des Ministerkomitees des Europarates vom 17. September 1987 zur Regelung der Benutzung personenbezogener Daten durch die Polizei
96MAGGAM
97Palma documentDokument von Palma
98drug abuseDrogenmissbrauch
99dextropropoxipheneDextropropoxyphen
100ecgonine methyl esterEcgonin Methylester
101cannabisCannabis
102piracySeeräuberei
103financial penaltyGeldbuße
104to waive immunityauf die Immunität von der Gerichtsbarkeit verzichten
105CELADCELAD
106IVDUFixer
107abusemissbräuchliche Verwendung
108Coordinators’ Group on DrugsGruppe der Koordinatoren “Drogenbekämpfung”
109European network of health data on drug abuseEuropäisches Datennetz über die gesundheitlichen Auswirkungen des Drogenmissbrauchs
110reliability of tests on body fluids to detect the use of illicit drugsZuverlässigkeit von Tests zum Nachweis unerlaubter Drogen in Körperflüssigkeiten.
111injecting drug userinjizierender Drogenabhängiger
112PAHOPanamerikanische Gesundheitsorganisation
113Inter-American Programme of action of Rio de Janeiro against the illicit use and production of narcotic drugs and psychotropic substances and traffic thereinInteramerikanisches Programm von Rio de Janeiro zur Bekämpfung des Konsums und der Erzeugung von Suchtstoffen und psychotropen Substanzen sowie des illegalen Handels mit diesen Stoffen
114UNFDACFonds der Vereinten Nationen zur Bekämpfung des Drogenmissbrauchs
115CICADCICAD
116HONLEAHONLEA
117ASEPASEP
118Operations GroupOperativgruppe
119national liaison officernationaler Verbindungsbeamter
120Sub-Division for General CrimeUnterabteilung Kriminalität der Interpol
121Police Division (of Interpol)Polizei-Abteilung (der Interpol)
122ICPCICPC
123coordinated measures for preventing drug addiction and coping with drug addictskoordinierte Massnahmen zur Verhütung der Drogenabhängigkeit und zur Betreuung der Drogenabhängigen
124CELADCELAD-Gruppe
125essential chemicalsGrundchemikalien
126CMOUmfassendes Multidisziplinäres Aktionsprogramm
127benzylmethylacetoneBenzil-Methylaceton
128European narcotics data fileeuropäisches Register der Suchtstoffe
129agreement on the prevention, control and curbing of drug abuse and the unlawful trade in and production of narcotics, psychotropic drugs and related chemical substancesAbkommen zur Verhütung, Kontrolle und Eindämmung des Drogenmissbrauchs, des unerlaubten Handels mit und der unerlaubten Herstellung von Betäubungsmitteln, psychotropen Stoffen und damit im Zusammenhang stehenden chemischen Stoffen
130Single ConventionEinheits-Übereinkommen von 1961 über Suchtstoffe
131Select Committee of Experts on International Cooperation as regards Search, Seizure and Confiscation of the Proceeds from CrimeExpertenausschuss über internationale Zusammenarbeit betreffend Aufspürung und Beschlagnahme der aus Verbrechen herrührenden Erlöse
132Cooperation group to combat drug abuse and illicit trafficking in drugsGruppe für die Zusammenarbeit bei der Bekämpfung von Drogenmissbrauch und illegalem Drogenhandel (Pompidou-Gruppe)
133ASEPASEP
134Agreement concerning the prevention and suppression of drug trafficking and misuse of drugsAbkommen über die Verhütung und Unterbindung des illegalen Drogenhandels und der illegalen Drogenverwendung
135World Ministerial Summit to Reduce the Demand for Drugs and to Combat the Cocaine ThreatWeltgipfel auf Ministerebene zur Verringerung des Drogenkonsums und zur Bekämpfung der Kokaingefahr
136educatorErzieher
137error of factTatirrtum
138Cooperation Group of Drug Control Services at European AirportsArbeitsgruppe für die Zusammenarbeit der Dienststellen für Drogenbekämpfung in den europäischen Flughäfen
139information network linked to drug traffickingDrogenhandel-Informationsnetz
140ICDAITInternationale Konferenz über den Drogenmissbrauch und den illegalen Drogenhandel
141controlled deliverykontrollierte Lieferung
142overdosageÜberdosierung
143aggravating circumstanceerschwerender Umstand
144summary documentSynthesedokument
145disintoxication drugsEntwöhnungsmedikamente
146stowawayblinder Passagier
147opiate intakeDrogeneinnahme
148law enforcementRechtsdurchsetzung
149to initiate an investigationeine Untersuchung einleiten
150withdrawal symptomsEntzugserscheinungen
151Golden CrescentGoldener Halbmond
152Golden TriangleGoldenes Dreieck
153danger to societyGemeingefährlichkeit
154previous historyfrühere Erfahrungen
155FATFArbeitsgruppe “Bekämpfung der Geldwäsche und der Terrorismusfinanzierung”
156smurfingsmurfing
157European Plan to combat drugsEuropäischer Drogenbekämpfungsplan
158money transferGeldüberweisung
159laundering channelGeldwäschekanäle
160illegal immigrantillegaler Einwanderer
161United Nations Convention against Illicit Traffic in Narcotic Drugs and Psychotropic SubstancesSuchtstoffübereinkommen 1988
162trade in precursorsHandel mit Drogengrundstoffen
163FOPACFOPAC
164markingKennzeichen
165act of terrorismTerrorakt
166political offencepolitische Straftat
167extradition requestAuslieferungsersuchen
168obligation to extraditeAuslieferungspflicht
169extraditable offenceauslieferungsfähige strafbare Handlung
170custodial sentenceFreiheitsentziehung
171detention orderdie Freiheit beschränkende Maßregel der Sicherung und Besserung
172onward extraditionWeiterlieferung
173transitDurchbeförderung
174fraudBetrug
175terrorist organisationterroristische Vereinigung
176forgeryFälschung
177drug traffickingDrogenhandel
178counter-narcoticsDrogenbekämpfung
179spectrum librarySpektrenbibliothek
180trace contaminantsSpurenverunreinigungen
181fiscal fraudAbgabenhinterziehung
182consequences under criminal lawstrafrechtliche Folgen
183primary preventionPrimärprävention
184cannabis plantCannabispflanze
185coca bushKokastrauch
186coca leafKokablatt
187ecgonineEcgonin
188ecgonine alkaloidEkgonin-Alkaloid
189poppy strawMohnstroh
190production or manufacture of drugsGewinnung oder Herstellung von Suchtstoffen
191extraction of alkaloidsAusziehen von Alkaloiden
192diversionBestimmungsänderung
193International Opium Convention (1912)Internationales Opiumabkommen
194Protocol for Limiting and Regulating the Cultivation of the Poppy Plant, the Production of, International and Wholesale Trade in, and Use of OpiumProtokoll über die Beschränkung und Regelung des Anbaues der Mohnpflanze, der Erzeugung von Opium, des internationalen Handels und Grosshandels mit Opium und seiner Verwendung
195Protocol Bringing under International Control Drugs outside the Scope of the Convention of 13 July 1931 for Limiting the Manufacture and Regulating the Distribution of Narcotic Drugs, as amended by the Protocol signed at Lake Success on 11 December 1946Protokoll zur internationalen Überwachung von Stoffen, die von dem Abkommen vom 13. Juli 1931 zur Beschränkung der Herstellung und zur Regelung der Verteilung der Betäubungsmittel, geändert durch das am 11. Dezember 1946 in Lake Success unterzeichnete Protokoll, nicht erfasst werden
196Convention for Limiting the Manufacture and Regulating the Distribution of Narcotic DrugsAbkommen zur Beschränkung der Herstellung und zur Regelung der Verteilung der Betäubungsmittel
197raw opiumRohopium
198medicinal opiumOpium für medizinische Zwecke
199Indian hempindischer Hanf
200reception centreAufnahmezentrum
201treatment communitiesTherapiegemeinschaften
202residential treatment communitiestherapeutische Wohngemeinschaften
203reintegration unitsWiedereingliederungszentren
204psychotherapypsychotherapeutische Massnahmen
205United Nations narcotics laboratorySuchtstofflaboratorium der UNO
206intravenous drug useintravenöse Drogenabhängigkeit
207detoxication centreEntziehungsanstalt
208scientific crime detectionKriminaltechnik
209United Nations Congress on the Prevention of Crime and the Treatment of OffendersKongress der Vereinten Nationen für Verbrechensverhütung und die Behandlung Straffälliger
210opiate officinal preparationsoffizinelle opiumhaltige Zubereitungen
211officinal opiumoffizinelles Opium
212after-careNachsorge
213lysergic acidLysergsäure
214demand reductionVerkürzung der Nachfrage
215oral testimonyVernehmung von Zeugen
216OCOK
217confiscationEinziehung
218narcotic plantsBetäubungsmittelpflanzen
2191-phenyl-2-propanone1-Phenyl-2-propanon
220anthranilic acidAnthranilsäure
221piperidinePiperidin
222regional formations of the technical groupTechnische Arbeitsgruppe (regionale Teilgruppen)
223chemical industrychemische Industrie
224gross negligenceLeichtfertigkeit
225Convention on Laundering, Search, Seizure and Confiscation of the Proceeds from CrimeGeldwäsche-Übereinkommen
226money laundererGeldwäscher
227Convention on Stolen or Illegally Exported Cultural ObjectsÜbereinkommen über gestohlene oder rechtswidrig ausgeführte Kulturgüter
228facilitation networkSchleusernetz
229Hostages ConventionInternationales Übereinkommen gegen Geiselnahme
230cannabis oilHaschischöl
231cross-border surveillancegrenzüberschreitende Observation
232request for assistanceRechtshilfeersuchen
233discreet checkverdeckte Kontrolle
234specific checkgezielte Kontrolle
235rehabilitationRehabilitation
236police cooperationpolizeiliche Zusammenarbeit
237Dublin GroupDublin-Gruppe
238prohibition on disposals of propertyVerfügungsverbot
239International Convention for the Suppression of the Circulation of and Traffic in Obscene PublicationsInternationale Übereinkunft zur Bekämpfung der Verbreitung und des Vertriebs unzüchtiger Veröffentlichungen
240International Convention for the Suppression of the Traffic in Women and ChildrenInternationale Übereinkunft zur Unterdrückung des Frauen- und Kinderhandels
241border crossingGrenzübergang
242criminal offenceStraftat
243arrest pending trialU-Haft
244right to apprehendFesthalterecht
245UNDCPProgramm der Vereinten Nationen für die internationale Drogenbekämpfung
246agent of infectionKrankheitserreger
247confirmation testGegentest
248withdrawal treatmentEntzugsbehandlung
249to divert for the illicit manufacture of narcotic drugszur unerlaubten Herstellung von Suchtstoffen abzweigen
250screening by urine testingUrintests
251high-risk behaviour groupRisikogruppe
252sharing syringesgemeinsame Benutzung des Injektionsbestecks
253programmes for the treatment and prevention of drug abuseProgramme der Suchthilfe und -verhütung
254reinfectionNeuinfizierung
255vertical transmission (mother-baby)vertikale Übertragung (von der Mutter auf das Kind)
256nuclear crimeNuklearkriminalität
257Oslo Conference on Illicit Drug Abuse Problems1.gesamteuropäische Ministerkonferenz über die Zusammenarbeit bei Problemen des Missbrauchs von illegalen Drogen
258European Central Criminal Investigation Office (Europol)Europäische Kriminalpolizeiliche Zentralstelle (EUROPOL)
259EDIUEDIU
260Regional Formation of the Dublin Groupregionale Dublin-Gruppe
261money launderingGeldwäsche
262relay stationRelaisstation
263DEAAbteilung für Drogenbekämpfung des US-Justizministeriums
264UN Programme on Crime Prevention and Criminal JusticeProgramm der Vereinten Nationen auf dem Gebiet der Verbrechensverhütung und der Strafrechtspflege
265CATFArbeitsgruppe “Drogengrundstoffe”
266criminalisticsForensik
267to infringe a Community trade markeine Gemeinschaftsmarke verletzen
268tamperingunbefugter Eingriff
269unlawful actHandlung, die das Recht verletzt
270asset-sharingAufteilung des Vermögens von Drogenhändlern
271EDPWEuropäische Woche der Suchtprävention
272Vienna GroupWiener Gruppe
273EMCDDABeobachtungsstelle
274Eastern Europe Regional Formation of the Dublin GroupRegionalgruppe “Osteuropa” der Dublin-Gruppe
275Southwest Asia Regional Formation of the Dublin GroupRegionalgruppe “Sudwestasien” der Dublin-Gruppe
276JICCGemeinsame Stelle für Informationskoordinierung
277coca pasteKokapaste
278Management Board of the European Monitoring Centre for Drugs and Drug AddictionVerwaltungsrat der Europäischen Beobachtungsstelle für Drogen und Drogensucht
279European Police OfficeEuropol
280UV reactionUV-Reaktion
281offender (group) analysisTäteranalyse
282specific profile analysisspezifische Profilanalyse
283crime analysisKriminalitätsanalyse
284general profile analysisallgemeine Profilanalyse
285(crime control) method analysisAnalyse der Kriminalitätsbekämpfungsmethoden
286crime pattern analysisKriminalitätsbildanalyse
287case analysisFallanalyse
288comparative case analysisvergleichende Fallanalyse
289criminal judicial cooperationjustizielle Zusammenarbeit in Strafsachen
290Lower Tier meeting of the Dublin GroupSitzung der Dublin-Gruppe auf nachgeordneter Ebene
291Upper Tier meeting of the Dublin GroupSitzung der Dublin-Gruppe auf höherer Ebene
292beneficial ownerwirtschaftlicher Eigentümer
293UNICRIInterregionales Forschungsinstitut der Vereinten Nationen für Kriminalität und Rechtspflege
294MDGMini-Dublin-Gruppe
295EDUEDU
296EFSAussengrenzenstrategie
297Precursors DirectiveGrundstoffe-Richtlinie
298Code of Conduct for Law enforcement OfficialsVerhaltenskodex für Beamte mit Polizeibefugnissen
299drug courierDrogenkurier
300seminar on drug-related outreach workSeminar über die Kontaktaufnahme zu Drogenabhängigen
301propertyVermögensgegenstände
302the possession, purchase or cultivation of narcotic drugs or psychotropic substances for personal consumptionBesitz, Kauf oder Anbau von Suchtstoffen oder psychotropen Stoffen für den persönlichen Verbrauch
303order of confiscation issued by the requesting Partyvon der ersuchenden Vertragspartei erlassene Einziehungsentscheidung
304Balkans/Middle East Regional Formation of the Dublin GroupRegionalgruppe “Balkan/Naher Osten” der Dublin-Gruppe
305Levant Drugs Working PartyGruppe “Drogen” (Östliche Mittelmeerländer)
306sequestrationSicherungspfändung
307objection of inadmissibilityAnfechtung der Zulässigkeit
308posting of liaison officersEinsatz von Verbindungsbeamten
309drug precursorDrogenausgangsstoff
310alternative developmentalternative Entwicklung
311telephone tappingAbhören des Telefonverkehrs
312immigrants handled by (illegal immigration) networksGeschleuste
313security clearanceSicherheitsüberprüfung
314fiscal offencefiskalische strafbare Handlung
315prescriptionVerjährung
316extradition of nationalsAuslieferung eigener Staatsangehöriger
317military offencemilitärische Straftat
318racist and xenophobic actsrassistische und fremdenfeindliche Handlungen
319perpetratorTäter
320IOCdas internationale organisierte Verbrechen
321life imprisonmentlebenslange Freiheitsstrafe
322extraditionAuslieferungsverfahren
323environmental crimeUmweltkriminalität
324prevent diversion of substances used for the purpose of illicit manufacture of narcotic drugs or psychotropic substances…verhindern, dass… Stoffe zur unerlaubten Herstellung von Suchtstoffen und psychotropen Stoffen abgezweigt werden
325methods of diversion and illicit manufactureMethoden der Abzweigung und der unerlaubten Herstellung
326NCISNCIS
327NDIUNDIU
328ASFASF
329MDEA3,4-Methylen-Dioxy-Ethylamphetamin
330JSBGKI
331criminal intelligence practiceIntelligence-Arbeit
332financial investigationsFinanzermittlungen
333forms of crimeErscheinungsformen der Kriminalität
334investigation analysisErmittlungsanalyse
335drug tourismDrogentourismus
336intelligence divisionAbteilung “Intelligence” (EUROPOL)
337caretaker coordinatorgeschäftsführender Koordinator
338support division (Europol)Abteilung “Logistik” (EUROPOL)
339EDU manualEDU-Handbuch
340ELO-FormELO-Formblatt
341DOCWGGruppe “Drogen und organisierte Kriminalität”
342access control deviceZugangskontrollgerät
343user-privilege conceptBerechtigungskonzept
344encryption softwareVerschlüsselungssoftware
345log fileProtokolldatei
346personnel drivebenutzerspezifisches Laufwerk
347world drivebereichsübergreifendes Laufwerk
348protection racketSchutzgelderpressung
349criminal investigationErmittlungsverfahren
350homicideTötung
351arsonBrandstiftung
352counterfeitingGeldfälschung
353extortionErpressung
354for questioningzum Zwecke der Vernehmung (festhalten)
355Central Office Against Illegal Drug TraffickingOCRTIS
356pre-convention phaseVorphase des Übereinkommens
357operational and strategic analysisoperative und strategische Analyse
358analysis sectionAnalyseabteilung
359strategic intelligence reportBericht über strategische Erkenntnisse
360strategic intelligence bulletinInformationsschrift über strategische Erkenntnisse
361crime statisticsKriminalstatistiken
362investigative teamErmittlungsgruppe
363inferential statisticsanalytische Statistiken
364descriptive statisticsbeschreibende Statistiken
365encrypted faxKrypto-Fax
366EDU Supervisory boardEDU-Aufsichtsstelle
367serious forms of international crimeschwerwiegende Formen der internationalen Kriminalität
368strategic intelligencestrategische Auswertung
369national operation resourcesauf nationaler Ebene für operative Aufgaben vorhandene Ressourcen
370technical and forensic police methodskriminaltechnische und kriminalwissenschaftliche Methoden
371investigative proceduresErmittlungsmethoden
372photo substitutionLichtbildaustausch
373double criminalitybeiderseitige Strafbarkeit
374accessory extraditionakzessorische Auslieferung
375Ministerial Agreement on the establishment of the Europol Drugs UnitMinistervereinbarung über die Einrichtung der Europol-Drogeneinheit
376quasi-criminal offencesquasi-strafrechtliche Delikte
377spurious passportPseudoprodukt
378terrorist threatTerrordrohung
379Staff UnitStabstelle
380Drugs Case fileFDR
381FIODFIOD
382interception orderÜberwachungsanordnung
383interception subjectüberwachte Person
384lawful authorisationrechtmässige Genehmigung
385THBMenschenhandel
386(attribution of) security classification levels (to documents)Einstufung von Dokumenten in Geheimhaltungsgrade
387to comply with a security classificationals Verschlusssache behandeln
388operational analystAnalytiker für operative Analyse
389strategic analystAnalytiker für strategische Analyse
390committing an offenceBegehen einer Straftat
391hit-and-runFahrerflucht
392Financial police deskReferat für Finanzermittlungen
393criminal grouping(Straf)tätergruppierung
394mens reaAbsicht
395World Ministerial Conference on Organised Transnational CrimeWeltministerkonferenz zur Organisierten grenzüberschreitenden Kriminalität
396undercover agentV.E.
397hard dataharte Daten
398soft dataweiche Daten
399association to commit offencesBande
400UN Standard minimum rules for the administration of juvenile justice (The Beijing Rules)Beijing-Regeln
401Committee of Experts on the Treatment of Young Adult OffendersEuroparatsfachausschuss, der sich mit der Behandlung heranwachsender Straftäter befasst
402Central office for combating serious fraudOCRGDF
403Balkan pipelineBalkanroute
404unlawful supply of labourillegale Arbeitnehmerüberlassung
405connections between criminal offencesZusammenhänge von Straftaten
406EU Action Plan on DrugsAktionsplan der Europäischen Union zur Drogenbekämpfung
407criminal liabilitystrafrechtliche Haftung
408triadTriade
409small-time courierKleinschleuser
410Revolutionary Organisation 17 NovemberRevolutionäre Organisation 17. November
411multiple and serious offendersMehrfach- und Intensivtäter
412confiscation of the proceeds crimeVerfall krimineller Gewinne
413asset-strippingasset-stripping
414decertificationDezertifizierung
415fictitious documentFingierung
416Berlin Declaration on Increased Cooperation in Combating Drug Crime and Organised Crime in EuropeBerliner Erklärung über eine verstärkte Zusammenarbeit bei der Bekämpfung der Rauschgiftkriminalität und der Organisierten Kriminalität in Europa
417illicit trafficking in motor vehiclesKraftfahrzeugverschiebung
418index systemIndexsystem
419confidentialityGeheimhaltung
420sale, supply and handlingVerschaffung und Abgabe
421arrest for extradition purposesFestnahme mit dem Ziel der Auslieferung
422International Convention for the Suppression of the White Slave TrafficInternationales Übereinkommen zur Bekämpfung des Mädchenhandels
423controlled drugerfasste Droge
424situation reportLagebild
425recording criteriaErfassungskriterien
426facilitated aliengeschleuster Ausländer
427route of facilitationSchleusungsroute
428organised traffickinggewerbs- und bandenmässiges Einschleusen von Ausländern
429trafficking outAusschleusungen
430trafficking throughDurchschleusungen
431expulsionaufenthaltsbeendende Massnahme
432ECO messageECO-Meldung
433code of criminal procedureStrafprozessordnung
434Heads of European Customs Investigation ServicesLeiter der europäischen Zollfahndungsbehörden
435anti-fraud activityBekämpfung von Betrügereien
436product piracyProduktpiraterie
437Law Enforcement Monitoring FacilityÜberwachungseinrichtung der gesetzlich ermächtigten Behörde
438smuggling of sensitive goodsSchmuggel empfindlicher Güter
439accessoryBeitragstäter
440to obtain, collate and analyse information and intelligenceInformationen und Erkenntnisse sammeln, zusammenstellen und analysieren
441computerised system of collected informationautomatisierte Informationssammlungen
442confidentiality agreementGeheimschutzabkommen
443sensitive activitysicherheitsempfindliche Tätigkeit
444polysubstance dependenceMehrfachkonsum
445specific offenceeigenständiger Straftatbestand
446crime against peaceVerbrechen gegen den Frieden
447crime against humanityVerbrechen gegen die Menschheit
448criminal procedureStrafprozessrecht
449MLATMLAT
450sexual abusesexueller Missbrauch
451primary penaltyHauptstrafe
452supplementary penaltyZusatzstrafe
453confiscation of criminal proceedsAbschöpfung der Erträge aus Straftaten
454letter bombBriefbombe
455parcel bombSprengstoffpaket
456criminal activitykriminelle Aktivität
457related criminal offenceZusammenhangstat
458surrenderÜbergabe
459wrongful retention of funds from the general budget of the European Communitiesunrechtmässige Zurückbehaltung
460covert investigatorV.E.
461banditryBanditentum
462United Nations Rules for the Protection of Juveniles Deprived of their LibertyHavanna-Regeln
463European network of health-promoting schoolsNetz der gesundheitsfördernden Schulen
464repetitionRückfall
465Convention drawn up on the basis of Article K.3 of the Treaty on European Union, on simplified extradition procedure between the Member States of the European UnionÜbereinkommen aufgrund von Artikel K.3 des Vertrags über die Europäische Union über das vereinfachte Auslieferungsverfahren zwischen den Mitgliedstaaten der Europäischen Union
466management teamManagement-Team
467instrumentalityTatmittel
468cooperative witnessKronzeuge
469International Opium ConventionInternationales Opiumabkommen (1925)
470soft drugsweiche Drogen
471palm printHandflächenabdruck
472order opening a data fileErrichtungsanordnung
473false imprisonmentFreiheitsberaubung
474illicit trafficking in hormonal substances and other growth promotersillegaler Handel mit Hormonen und Wachstumförderern
475Council act drawing up the Convention based on Article K.3 of the Treaty on European Union, on the establishment of a European Police Office (Europol)Rechtsakt des Rates über die Fertigstellung des Übereinkommens aufgrund von Artikel K.3 des Vertrags über die Europäische Union über die Errichtung eines Europäischen Polizeiamts (Europol-Übereinkommen)
476property crimeEigentumskriminalität
477vulnerability to fraudBetrugsanfälligkeit
478remote sensing from the air or spaceFernerkundung mittels Luft- oder Satellitenaufnahmen
479electronic registerelektronische Datei
480detection systemFahndungssystem
481illicit trafficking in nuclear or radioactive materialsNuklearschmuggel
482aiding and abettingBeihilfe
483instigationAnstiftung
484FALSEFälschung
485document fraudDokumentenbetrug
486Convention based on article K.3 of the Treaty on European Union, on the Establishment of a European Police OfficeEuropol-Übereinkommen
487RILORILO
488white-collar crimeWeiße-Kragen-Kriminalität
489photographic/analytical data bankBild- und Analysedatenbank
490AWFArbeitsdatei zu Analysezwecken
491GERGER
492National Plan for the Fight against DrugsNationaler Rauschgiftbekämpfungsplan
493joint mediation unitGemeinsame Ermittlungseinheit
494subsidy fraudSubventionsbetrug
495corruptionBestechung und Bestechlichkeit
496ecstasy profiling systemEcstasy Profiling System
497Technical and Forensic Police Working PartyGruppe “Kriminaltechnik und -wissenschaft”
498Agreement on Illicit Traffic by Sea, Implementing Article 17 of the UN Convention against Illicit Traffic in Narcotic Drugs and Psychotropic SubstancesÜbereinkommen über den unerlaubten Verkehr auf See zur Durchführung des Artikels 17 des Übereinkommens der Vereinten Nationen gegen den unerlaubten Verkehr mit Suchtstoffen und psychotropen Stoffen
499Europol Intelligence AnalystIntelligence-Analytiker von Europol
500phenomena analysisAnalyse der Erscheinungsformen
501place of commissionBegehungsort
502conflicting requestsMehrheit von Auslieferungsersuchen
503tactical intelligenceoperative Auswertung
504operational intelligenceoperative Auswertung
505crime profilingErstellung von Täterprofilen
506investigation and intelligence task forcesStäbe für die Zusammenarbeit bei Ermittlungen und “Intelligence”
507drug seizureSicherstellung von Drogen
508asset seizureBeschlagnahme von Vermögenswerten
509forensic laboratorykriminaltechnisches Labor
510OFCOffshore-Bankplatz
511International Convention for the Suppression of the Traffic in Women of Full AgeÜbereinkommen zur Unterdrückung des Handels mit volljährigen Frauen
512scheduled substanceerfasster Stoff
513forerunner countryInitiativland
514Europol computer systemEuropol-Computersystem
515ballistic profilingErstellung ballistischer “Profile”
516chemical profilingErstellung chemischer “Profile”
517enforced prostitutionNötigung zur Prostitution
518CCPCJCCPCJ
519penal institutionHaftanstalt
520continued offencefortgesetzte Handlung
521STRshort tandem repeat
522active briberyBestechung
523passive briberyBestechlichkeit
524alleged crimeTatvorwurf
525suspicious transactionverdächtige Transaktion
526blackmailErpressung
527Agreement on precursors between the Community and the five countries of the Andean PactAbkommen über Grundstoffe zwischen der Gemeinschaft und den fünf Ländern des Andenpaktes
528Expert Group on DrugsGruppe der Drogensachverständigen
529Euro-Mediterranean Committee for the Barcelona processEuropa-Mittelmeer-Ausschuss für den Barcelona-Prozess
530active repentancetätige Reue
531predicate offenceHaupttat
532European Institute for Crime Prevention and Control affiliated with the United NationsEuropäisches Institut für Verbrechensverhütung und -bekämpfung
533EISEuropol-Informationssystem
534analysis groupAnalysegruppe
535authorised liaison officerermächtigter Verbindungsbeamter
536Chairman of the Joint Supervisory BodyVorsitzender der gemeinsamen Kontrollinstanz
537crime against life, limb or personal freedomStraftaten gegen Leben, körperliche Unversehrtheit und Freiheit
538murderTotschlag
539illicit trade in human organs and tissueillegaler Handel mit Organen und menschlichem Gewebe
540kidnappingEntführung
541hostage takingGeiselnahme
542crime against property or public goods including fraudStraftaten gegen fremdes Vermögen und staatliches Eigentum sowie Betrug
543illicit trafficking in cultural goods, including antiquities and works of artillegaler Handel mit Kulturgütern, einschließlich Antiquitäten und Kunstgegenstände
544illicit trafficking in arms, ammunition and explosivesillegaler Handel mit Waffen, Munition und Sprengstoffen
545illicit trafficking in endangered animal speciesillegaler Handel mit bedrohten Tierarten
546illicit trafficking in endangered plant species and varietiesillegaler Handel mit bedrohten Pflanzen- und Baumarten
547illegal money-laundering activitiesGeldwäschehandlungen
548filing referenceAktenzeichen
549analysis projectAnalyseprojekt
550draw up a report for a retrieval of personal dataden Abruf von personenbezogenen Daten protokollieren
551NBPANBPA
552football hooliganismFussballrowdytum
553fraud affecting the European Communities’ financial interestsBetrug zum Nachteil der finanziellen Interessen der Europäischen Gemeinschaften
554serious fraudschwerer Betrugsfall
555minor fraudminderschwerer Betrugsfall
556tax offenceAbgabendelikt
557customs duty offenceZolldelikt
558enforcement of sentences passed in another Member StateVollstreckung von Urteilen, die in einem anderen Mitgliedstaat ergangen sind
559(the) scene of the crimeTatort
560stewardOrdner
561Ad hoc Working Party on Latin America and the Caribbean (Drugs)Sachverständigengruppe “Lateinamerika/Karibik” (Drogen)
562street level valueSchwarzmarktwert
563CICStrafprozessordnung
564preliminary inquiryErmittlungen
565VICLASAnalysesystem zur Serienzusammenführung von Gewaltverbrechen (2)
566exchange of best practice in law enforcementAustausch bewährter Praktiken im Bereich Strafverfolgung
567direct or indirect sale of narcotic drugsunmittelbare oder mittelbare Abgabe von Suchtstoffen
568the flow of money via airportsGeldtransfer über Flughäfen
569coverLegende
570shipriderSchiffsbegleitung
571cross-border hot pursuitNacheile
572self-defenceNotwehr
573black tarTeer
574HENULeiter der nationalen Europol-Stellen
575HClHCl
576NBRFNBRF
577OPBATOPBAT
578NNICCNNICC
579master planGesamtplan
580lawful interception of telecommunicationsrechtmässige Überwachung des Telekommunikationsverkehrs
581RSSRSS
582Chairman of the Management Board of the European Monitoring Centre for Drugs and Drug AddictionVorsitzender des Verwaltungsrates der Europäischen Beobachtungsstelle für Drogen und Drogensucht
583drug cartelDrogenkartell
584compensated eradicationmit einem Ausgleich verbundene Ausmerzung
585catMethcathinon
586reporting centre for unusual transactionsMeldestelle für ungewöhnliche Transaktionen
587synthetic drugsynthetische Droge
588CFATFCFATF
589Egmont GroupEgmont-Gruppe
590methamphetamineMethamphetamin
591DTRCISDTRCIS
592Central Directorate for Drugs ControlZentraldirektorat zur Drogenbekämpfung
593acts of violence against the life, physical integrity or liberty of a personGewalttat gegen das Leben, die körperliche Unversehrtheit oder die Freiheit einer Person
594Convention drawn up on the basis of Article K.3 of the Treaty on European Union, relating to extradition between the Member States of the European UnionÜbereinkommen aufgrund von Artikel K.3 des Vertrags über die Europäische Union über die Auslieferung zwischen den Mitgliedstaaten der Europäischen Union
595CRIPCRIP
596IDERIDER-Programm
597PTAPPTAP
598domestic cultivationDrogenanbau im Inland
599REDTRACREDTRAC
600ICITAPICITAP
601computer crimeComputerkriminalität
602improvised weaponryunkonventionelle Waffen
603CPSStaatsanwaltschaft
604pre-precursorVorstoff für Drogengrundstoffe
605Agreement between the European Community and the Republic of Bolivia on precursors and chemical substances frequently used in the illicit manufacture of narcotic drugs or psychotropic substancesAbkommen zwischen der Europäischen Gemeinschaft und der Republik Bolivien über Grundstoffe und chemische Stoffe, die häufig für die unerlaubte Herstellung von Suchtstoffen oder psychotropen Substanzen verwendet werden
606directory of specialised competences, skills and expertise in the matter of the fight against international organized crimeVerzeichnis der besonderen Fähigkeiten und Fachkenntnisse auf dem Gebiet der Bekämpfung der internationalen organisierten Kriminalität
607crime related to drugsDrogenkriminalität
608ENFSIENFSI
609accessory before the factAnstifter
610illegal gamblingunerlaubte Veranstaltung von Glücksspielen
611pusherPusher
612cultivation of drugsDrogenanbau
613eavesdropping operationsgrosser Lauschangriff
614Convention established by the Council in accordance with Article 34 of the Treaty on European Union, on Mutual Assistance in Criminal Matters between the Member States of the European UnionÜbereinkommen über die Rechtshilfe in Strafsachen zwischen den Mitgliedstaaten der Europäischen Union
615MDA3,4 Methylendioxyamphetamin
616core nominalnamentlich bekannter Haupttäter, namentlich erfasste Hauptfigur
617designer drugDesignerdroge
618credit card fraudKreditkartenbetrug
619covert investigationverdeckte Ermittlungen
620PECSPECS
621photo-analytical database on drugsDatenbank zur photoanalytischen Erfassung von Drogen
622drug trafficking offenceDrogenhandelsdelikt
623rehabilitation of drug addictsReintegration ehemaliger Drogenabhängiger
624shiprider agreementVereinbarung über Schiffsbegleitung
625CBPKokainbase
626peer pressureGruppenzwang
627DNA profileDNA-Identifizierungsmuster
628inhalantSchnüffelstoff
629cocaine hydrochlorideKokainhydrochlorid
630herbal cannabisCannabiskraut
631Meeting of Heads of National Drug Law Enforcement Agencies, Latin America and the Caribbean (HONLEA)Tagung der Leiter nationaler Drogenbekämpfungsbehörden
632continuing offenceDauerdelikt
633instantaneous crimeEinzelstraftat
634DoSDienstleistungsverhinderung
635agent provocateur(polizeilicher) Lockspitzel
636active ingredients with narcotic propertiesStoffe mit Suchtgiftwirkung
637OCUAKE
638MOmodus operandi
639criminal informationkriminalpolizeiliche Information
640voice identificationStimm-Erkennung
641Logo ProjectLogo-Projekt
642CSEsexuelle Ausbeutung von Kindern
643Agreement between the European Community and the United Mexican States on cooperation regarding the control of precursors and chemical substances frequently used in the illicit manufacture of narcotic drugs or psychotropic substancesAbkommen zwischen der Europäischen Gemeinschaft und den Vereinigten Staaten von Mexiko über die Zusammenarbeit bei der Kontrolle von Grundstoffen und chemischen Stoffen, die häufig für die unerlaubte Herstellung von Suchtstoffen oder psychotropen Substanzen verwendet werden
644criminal policyKriminalpolitik
645criminalisationEinstufung als Straftatbestand
646the crime of conspiracyvon kriminellen Organisationen begangene Straftaten (OK-Straftaten)
647stolen, misappropriated or lostgestohlen, unterschlagen oder sonst abhandengekommen
648speed-ballSpeedball
649Committee of Experts on crime in CyberspacePC-CY
650Recommendation (92) 1 of 10 February 1992 of the Council of Europe Committee of Ministers on the use of Analysis of Deoxyribonucleic Acid (DNA) within the framework of the criminal justice systemEmpfehlung (92) 1 des Ministerkomitees des Europarats vom 10. Februar 1992 über die Anwendung der Analyse der Desoxyribonukleinsäure (DNA) im Rahmen der Strafrechtspflege
651BSTFTask Force “Organisierte Kriminalität im Ostseeraum”
652National Police Agencynationale Polizei
653ATSATS
654interceptionÜberwachung
655missing and unidentified personsvermisste Personen und nicht identifizierte Personen
656to conduct “dawn raids”eine unangemeldete Durchsuchung vornehmen
657chemical impurity profilingErstellung chemischer Profile anhand von Verunreinigungen
658Second Protocol, drawn up on the basis of Article K.3 of the Treaty on European Union, to the Convention on the protection of the European Communities’ financial interestsZweites Protokoll aufgrund von Artikel K.3 des Vertrags über die Europäische Union zum Übereinkommen über den Schutz der finanziellen Interessen der Europäischen Gemeinschaften
659Agreement between the European Community and the United States of America on precursors and chemical substances frequently used in the illicit manufacture of narcotic drugs or psychotropic substancesAbkommen zwischen der Europäischen Gemeinschaft und den Vereinigten Staaten von Amerika über Grundstoffe und chemische Stoffe, die häufig für die unerlaubte Herstellung von Suchtstoffen oder psychotropen Substanzen verwendet werden
660involvement as an accessory in an offenceBeihilfe zu einer Straftat
661seizure, confiscation or removal of the instruments and proceeds of fraudBeschlagnahme, Einziehung oder Entziehung der Tatinstrumente und Erträge aus dem Betrug
662child abuse networkKinderpornographiering
663sexual assault of minorssexuelle Gewalt gegenüber Minderjährigen
664ephedraEphedra
665majors listListe der wichtigsten Drogenproduktions- oder -transitländer
666International Convention for the Suppression of Terrorist BombingsInternationales Übereinkommen zur Bekämpfung terroristischer Bombenanschläge
667commercial carriergewerbliches Frachtunternehmen
668Action plan to combat organised crimeAktionsplan zur Bekämpfung der organisierten Kriminalität
669Joint follow-up groupGemeinsame Follow-up-Gruppe
670State of the offenceStaat der Zuwiderhandlung
671counterfeiting and product piracyNachahmung und Produktpiraterie
672high-tech crimeHigh-Tech-Kriminalität
673trusted collaboratorV-Mann
674trafficking in minorsHandel mit Minderjährigen
675programme of exchanges, training and cooperation for persons responsible for action to combat organised crime (FALCONE programme)Austausch-, Ausbildungs- und Kooperationsprogramm für Personen, die für die Bekämpfung der organisierten Kriminalität zuständig sind (FALCONE)
676criminal penaltyStrafe
677body searchLeibesvisitation
678murderMord
679rapeVergewaltigung
680illicit transportation of toxic and dangerous wasteunerlaubter Verkehr mit giftigen und schädlichen Abfällen
681HARCHARC
682coercive investigation measureZwangsmassnahme
683payment card crimeZahlungskartenkriminalität
684crime scene managementTatortarbeit
685police and judicial cooperation in criminal matterspolizeiliche und justizielle Zusammenarbeit in Strafsachen
686incommunicado detentionHaft ohne Kontakt zur Außenwelt
687National Council for Crime PreventionBeirat für Kriminalitätsverhütung
688front companyfront store
689FIUFIU
690Additional Protocol to the Convention on the Transfer of Sentenced PersonsZusatzprotokoll zum Übereinkommen über die Überstellung verurteilter Personen
691crime preventionKriminalprävention
692robberyRaub
693forensic researchkriminaltechnische Forschung
694Royal Netherlands Military ConstabularyKönigliche Marechaussee
6954-MTA4-MTA
696MBDBMBDB
697request for assistanceAmtshilfeersuchen
698tracing of propertyErmittlung von Vermögensgegenständen
699geopoliticsGeopolitik
700EU Manual on controlled deliveriesEU-Handbuch über kontrollierte Lieferungen
701releasefreilassen
702small-scale traffickingAmeisenhandel
703restraint of assetsBeschlagnahme von Vermögensgegenständen
704IWFIWF
705evaluation teamGutachterausschuss
706TITI
707the “Schleierfahndung” techniqueSchleierfahndung
708security netSicherheitsschleier
709skimmingSkimming
710Anti-Bribery ConventionÜbereinkommen über die Bekämpfung der Bestechung ausländischer Amtsträger im internationalen Geschäftsverkehr
711container fraudSchmuggel im Containerverkehr
712influence peddlingunerlaubte Einflussnahme
713GRECOGRECO
714corporate crimeUnternehmenskriminalität
715recover the proceeds of fiscal fraudErträge aus Steuerhinterziehung einziehen
716governmental licencestaatliche Genehmigung
717national focus pointnationale Zentralstelle
718multidisciplinary integrated teammultidisziplinäres integriertes Team
719Criminal Law Convention on CorruptionStrafrechtsübereinkommen über Korruption
720request for assistanceErsuchen um Unterstützung
7214-bromo-2, 5-dimethoxyamphetamine2,5-Dimethoxy-4-bromamphetamin
722MBDBMBDB
723UN Office on Drugs and CrimeBüro der Vereinten Nationen für Drogen- und Verbrechensbekämpfung
724legal economic sectorlegaler Wirtschaftssektor
725detectionAufdeckung
726violence against children and young peopleGewalt zum Nachteil von Kindern und Jugendlichen
727association analysisBeziehungsanalyse
728telephone record analysisTelefonüberwachungsanalyse
729event flow and activity flow analysisEreignis- und Aktivitätsflussanalyse
730commodity flow analysisWarenflussanalyse
731vulnerability analysisGefährdungsanalyse
732intelligence processIntelligence-Prozess
733intelligence analysisAnalyse im Rahmen der kriminalpolizeilichen Auswertung
734advance deployment strategyVorverlagerungsstrategie
735Turkish gangstürkische Grossfamilien
736lethal devicetödliche Vorrichtung
737exemption from punishmentStrafbefreiung
738unlawful seizure of aircraftFlugzeugentführung
739smart drugSmart Drug
740RJopferorientierte Justiz
741CICPZentrum für internationale Verbrechensverhütung
742cocaine alkaloidKoka-Alkaloid
743coca-growingKokaanbau
744alternative development programmeProgramm der alternativen Entwicklung
745CORAHCORAH
746nursery plantJungpflanze
747narcoguerillaNarcoguerilla
748coca baseKokabase
749PEAHPEAH
750CORDEPCORDEP
751Narcotics LawBetäubungsmittelgesetz
752revolving credit fundrevolvierender Kreditfonds
753Convention on CybercrimeÜbereinkommen über Computerkriminalität
754Coordination and Cooperation Mechanism in the fight against drugsMechanismus zur Koordinierung und Zusammenarbeit im Bereich der Drogenbekämpfung
755petty form of an offenceOrdnungswidrigkeit
756permanent offenceZustandsdelikt
757press offencePressedelikt
758crime of omissionUnterlassungsdelikt
759major offenceVergehen
760serious crimeVerbrechen
761Declaration on the Guiding Principles of Drug Demand ReductionErklärung über die Leitgrundsätze für die Senkung der Drogennachfrage
762arms transferVerbringung von Waffen
763maceration pitMazerationsgrube
764coordinating agencyKoordinierungsstelle
765CONAPADCONAPAD
766anti-drug policeAntidrogenpolizei
767early releasevorzeitige Entlassung aus der Haft
768financial crimeFinanzkriminalität
769inquiryBeweisaufnahme
770disappearanceVerschwinden
771European Anti-Fraud OfficeEuropäisches Amt für Betrugsbekämpfung
772domestic violenceGewalt im häuslichen Umfeld
773Agreement between the European Community and the Republic of Chile on precursors and chemical substances frequently used for the illicit manufacture of narcotic drugs and psychotropic substancesAbkommen zwischen der Europäischen Gemeinschaft und der Republik Chile über Grundstoffe und chemische Stoffe, die häufig für die unerlaubte Herstellung von Suchtstoffen oder psychotropen Substanzen verwendet werden
774secondary preventionSekundärprävention
775tertiary preventionTertiärprävention
776ICPCInternationales Zentrum für Verbrechensverhütung
777European crime prevention awardEuropäischer Preis für Kriminalprävention
778ARSARS
779urban violence police exchange programmeAustauschprogramm für Beamte im Bereich Gewalt in den Städten
780Joint Action on money launderingGemeinsame Maßnahme betreffend Geldwäsche
781criminalisation of membership of a criminal organisationStrafbarkeit der Beteiligung an einer kriminellen Vereinigung
782aminorexAminorex
783brotizolamBrotizolam
784etryptamineEtryptamin
785flunitrazepamFlunitrazepam
786mesocarbMesocarb
787zipeprolZipeprol
788outreach workaufsuchende Arbeit
789Action Plan on International Cooperation on the Eradication of Illicit Drug Crops and on Alternative DevelopmentAktionsplan für internationale Zusammenarbeit bei der Ausmerzung des unerlaubten Anbaus von Betäubungsmittelpflanzen und für Alternative Entwicklung
790early warning information systemMechanismus für einen raschen Informationsaustausch
791preliminary inquirygerichtliche Voruntersuchung
792substitution treatmentSubstitutionsbehandlung, Substitutionstherapie
793two-tone guillocheszweifarbig verarbeitete Guillochen (pl.)
794strategic goodsstrategische Güter
795result offenceErfolgsdelikt
796agitation against an ethnic groupAgitation gegen eine ethnische Gruppe
797sexual offenceSexualstraftat
798environmental offenceUmweltdelikt
799drug offenceDrogendelikt
800serious crime against the environmentschwere Umweltkriminalität
801substituteErsatzstoff
802polytoxic pattern of consumptionpolitoxische Konsummuster
803established offenderEchttäter
804confiscation of proceedsGewinnabschöpfung
805International Convention for the Suppression of the Financing of TerrorismInternationales Übereinkommen zur Bekämpfung der Finanzierung des Terrorismus
806Kinefilm pouchKinefilmtasche
807covert surveillanceObservation
808adulterantZusatzstoff
809street drugStraßendroge
810cutting agentVerschnittstoff
811genetic fingerprintgenetischer Fingerabdruck
812CT authoritiesStellen für Terrorismusbekämpfung
813home-made heroin baseKompott
814deadly herointodbringendes Heroin
815CTBekämpfung des Terrorismus
816smuggling drugs concealed inside the bodyDrogenhandel durch Körperschmuggel
817CTIFBüro für die Verarbeitung finanzieller Informationen
818illicit arms traffickingillegaler Waffenhandel
819qualitative dataqualitative Angaben
820factual data/details of eventsSachverhaltsdaten
821suspect profileVerdachtsraster
822network of perpetratorsTätergeflecht
823passive sniffer dogpassiver Rauschgiftspürhund
824cross-checking mechanismCross-checking-Mechanismus
825BlueprintsBlueprints
826crime associated with the purchase of drugsBeschaffungskriminalität
827unusual transactionungewöhnliche Transaktion
828safe havenUnterschlupf
829FIU.NETFIU.NET
830College of Principal Public ProsecutorsKollegium der Generalprokuratoren
831sting operationScheingeschäft
832Coordination Unit for the Struggle Against DrugsKoordinierungseinheit für die Bekämpfung des Drogenhandels
83324-hour law enforcement point of contactrund um die Uhr besetzte Ansprechstelle bei den Strafverfolgungsbehörden
834conspiracy and association to commit offencesVerabredung einer strafbaren Handlung und Beteiligung an einer kriminellen Vereinigung
835administrative investigationadministrative Untersuchung
836external investigationexterne Untersuchung
837internal investigationinterne Untersuchung
838OLAF Supervisory CommitteeÜberwachungsausschuss des Europäischen Amtes für Betrugsbekämpfung
839crime prevention methodsMethoden zur Verhütung von Straftaten
840day-to-day administrationlaufende Geschäftsführung
841aggravated arsonschwere Brandstiftung
842National Criminal Investigation DepartmentReichskriminalpolizei
843biological stainbiologische Spur
844mutual evaluationgegenseitige Begutachtung
845Money Laundering Experts Groupinformelle Sachverständigengruppe “Geldwäsche”
846ion mobility spectrometerIonenmobilitätsspektrometer
847JITGEG
848pseudo-purchaseScheinkauf
849Palermo ConventionUNTOC
850petty thefteinfacher Diebstahl
851larcenyDiebstahl
852enslavementVersklavung
853elements of crimesVerbrechenselemente
854Office of the ProsecutorAnklagebehörde
855Trial DivisionHauptverfahrensabteilung
856Pre-Trial DivisionVorverfahrensabteilung
857urban crimeKriminalität in den Städten
858combating crime by preventative meanspräventive Verbrechensbekämpfung
859combating crime by law enforcementrepressive Verbrechensbekämpfung
860CEPOLCEPOL
861aggravated burglary and robberyschwerer Diebstahl
862aggravated receiving of stolen goodsHehlerei
863notification of a suspicious transactionVerdachtsmeldung
864investigation preliminary to prosecutionErmittlungsverfahren
865Partnership for SecuritySicherheitspartnerschaft
866hate crimeHasskriminalität
867Protocol against the Illicit Manufacturing of and Trafficking in Firearms, their Parts and Components and Ammunition, supplementing the United Nations Convention against Transnational Organized CrimeFeuerwaffen-Protokoll
868bullying at workMobbing
869Charter of the European Professional Associations in supporting the fight against organised crimeCharta der europäischen Berufsvereinigungen zur Unterstützung des Kampfes gegen die organisierte Kriminalität
870publicising information on wanted criminalsVeröffentlichung von Fahndungsaufrufen
871Danish Security and Intelligence ServicePET
872Manual on Bogus Drug DealsHandbuch zu Scheinkäufen
873ENCCEKBN
874SNOWOperation SNOW
875investigation of assetsVermögensausforschung
876EU guidelines for a common approach to suppress international terrorismEU-Leitlinien für ein gemeinsames Vorgehen gegen den internationalen Terrorismus
877Network of crime prevention expertsNetz der Experten der Verbrechensverhütung
878surveillance teamObservationsgruppe
879deferral of investigation or prosecutionAufschub der Ermittlungen oder der Strafverfolgung
880suspectTatverdächtiger
881identity theftIdentitätsdiebstahl
882GBVgeschlechtsbezogene Gewalt
883chargeAnklage
884Europol focal pointEuropol-Kontaktstelle
885street violenceStraßengewalt
886drug enforcementstrafrechtliche Verfolgung von Drogendelikten
887regional formation on Baltics of the Dublin GroupRegionalgruppe “Baltische Staaten” der Dublin-Gruppe
888specialised law enforcement servicespezialisierte Strafverfolgungsbehörde
889EU Police Chiefs Operational Task ForceEU-Task Force der Polizeichefs
890ESPOCESPOC
891law enforcement investigationstrafrechtliche Ermittlung
892G8 Senior Experts Group on Transnational Organized CrimeLyon-Gruppe
893determination of proper lawWürdigung durch das Gericht
894channel of communicationMeldeweg
895Internet stalkingCyber-Stalking
896cybercriminalCyberkrimineller
897ETSCETSC
898person under judicial investigationBeschuldigte
899placing under judicial examinationErhebung der Anklage
900European prison ruleseuropäische Strafvollzugsvorschriften
901grower countryAnbauland
902false bottomDoppelboden
903shallow-draught shipSchiff mit geringem Tiefgang
904bullyingBullying
905Consultative Group for PeruBeratende Gruppe für Peru
906ATLASEuropäischer Justizieller Atlas
907Technical Liaison Committeetechnischer Verbindungsausschuss
908Bari Joint DeclarationGemeinsame Erklärung von Bari
909CASECASE
910illegal loggingillegaler Einschlag
911forensic expertGerichtsarzt
912prosecution of drug traffickingstrafrechtliche Verfolgung von Drogenhandelsdelikten
913specialised prosecution unitspezialisierte Stelle der Staatsanwaltschaft
914The Prevention and Control of Organised Crime: A European Union Strategy for the beginning of the new MillenniumPrävention und Bekämpfung der organisierten Kriminalität: Eine Strategie der Europäischen Union für den Beginn des neuen Jahrtausends
915multidisciplinary teammultidisziplinäre Ermittlungsgruppe
916mobile patrol squadmobile Streife
917crime analystAuswertungsspezialist
918analysis of criminal files and recordsAnalyse von Akten und Aufzeichnungen
919intelligence unitfür die “Intelligence”-Arbeit zuständige Stelle
920meeting of the Police Chiefs of the countries of the Adriatic basinTreffen der Polizeichefs der Anrainerstaaten der Adria
921European Conference on Development and Security in the Adriatic and Ionian Areaeuropäische Konferenz über Entwicklung und Sicherheit im Gebiet der Adria und des Ionischen Meeres
922operational contact pointAnlaufstelle
923child offenderjugendlicher Straffälliger
924The Forty Recommandationsvierzig Empfehlungen
925security beltSicherheitsgürtel
926question of lawRechtsfrage
927to retain jurisdiction over the matterdie Zuständigkeit für die Angelegenheit behalten
928to be proceeded againstgegen jemand wird gerichtlich vorgegangen
929testimony made under oathbeeidete Zeugenaussage
930questioningVernehmung
931voluntary appearancefreiwilliges Erscheinen
932consent to surrenderZustimmung zur Übergabe
933IMoLINInternationales Netz zur Bekämpfung der Geldwäsche
934GPMLGlobales Programm gegen Geldwäsche
935medical and psychological supportmedizinische und psychologische Betreuung
936South East Asia regional formation of the Dublin GroupSüdostasien-Regionalgruppe der Dublin-Gruppe
9376 + 2 group on Afghanistan6 + 2 Gruppe über Afghanistan
938drug-free societydrogenfreie Gesellschaft
939tablet machineTablettiermaschine
940bodily sampleKörperprobe
941exchange of police intelligenceAustausch polizeilicher Erkenntnisse
942forgery detection equipmentGeräte zum Erkennen von Fälschungen
943layeringVerschiebung
944decriminalisationEntkriminalisierung
945crime mappingCrime mapping
946anti-terrorist equipmentGerät zur Terrorismusbekämpfung
947incapacitating substancekampfunfähig machender Stoff
948placementEinschleusung
949integrationIntegration
950intentional offencevorsätzlich begangene Straftat
951mediation in criminal casesSchlichtung in Strafsachen
952asset freezeEinfrieren von Vermögensgegenständen
953financial investigatorFinanzermittler
954bio-terrorismB-Terrorismus
955cyberterrorismCyberterrorismus
956counterfeiting of the euroFälschung des Euro
957administrative offenceOrdnungswidrigkeit
958CAPECAPE
959sniffingSniffing
960WADAInternationale Anti-Doping-Agentur
961cyber attackComputerangriff
962social engineering„Social Engineering“
963fenetyllineFenetyllin
964mescalineMeskalin
965psilocybinePsilocybin
966muscarineMuskarin
967NederhashNederwiet
968overstayerPerson, die einen befristeten Aufenthalt rechtswidrig überschreitet
969proportionality of criminal offences and penaltiesGrundsatz der Verhältnismäßigkeit im Zusammenhang mit Straftaten und Strafen
970CNACMAZ
971Basic Principles on the Use of Force and Firearms by Law Enforcement OfficialsGrundprinzipien für die Anwendung von Gewalt und den Gebrauch von Schusswaffen durch Beamte mit Polizeibefugnissen
972FIDEANS
973honour killingEhrenmord
974acid attackSäureangriff
975POCpoint of compromise
976Appeals DivisionBerufungsabteilung
977regulations of the CourtGeschäftsordnung des Gerichtshofs
978sexual violencesexuelle Gewalt
979liabilitySchuldfähigkeit
980NCCTnicht kooperative Länder und Gebiete
981error of lawfehlerhafte Rechtsanwendung
982therapy protocolBehandlungsprotokoll
983EUCARIS TreatyEUCARIS-Vertrag
984CDGzentrale Dublin-Gruppe
985assault on propertyEigentumsdelikt
986electronic surveillanceelektronisch überwachter Hausarrest
987electronic taggingelektronische Fussfessel
988BAAlkoholämie
989victim-offender mediationTOA
990OSIoffene Informationsquellen
991scenario writingSzenario-Technik, Szenario-Methode, Szenario-Writing
992high crime hot spotGebiet mit hoher Kriminalitätsbelastung
993ISTRAISTRA
994policingPolizeiarbeit
995negligence offenceFahrlässigkeitsdelikt
996Protocol drawn up on the basis of Article 43(1) of the Convention on the establishment of a European Police Office (Europol Convention) amending Article 2 and the Annex to that ConventionProtokoll erstellt aufgrund von Artikel 43 Absatz 1 des Übereinkommens über die Errichtung eines Europäischen Polizeiamts (Europol-Übereinkommen) zur Änderung von Artikel 2 und des Anhangs jenes des Übereinkommens
997injection roomDrogenkonsumraum
998precursor monitoringGrundstoffüberwachung
999sweatshopAusbeuterbetrieb
1000UN Convention against CorruptionÜbereinkommen der Vereinten Nationen gegen Korruption
1001crime-proofingAbsicherung gegen kriminelle Handlungen
1002background investigationUmfeldermittlung
1003EUCPNENKP
1004order freezing assets or evidenceEntscheidung über die Sicherstellung von Vermögensgegenständen oder Beweismitteln
1005LSMLSM
1006controlled substancekontrollierter Stoff
1007ARQFragebogen zu den Jahresberichten
1008DEUTDEUT
1009heroin substitution treatmentHeroin-Substitutionstherapie
1010heroin supported treatmentheroingestützte Behandlung
1011Financial Intelligence UnitFinanzpolizei
1012proof houseBeschussamt
1013proof markBeschusszeichen
1014European Forum for the prevention of organised crimeEuropäisches Forum zur Verhütung von organisierter Kriminalität
1015Basic Principles on the Independence of the JudiciaryGrundprinzipien der Unabhängigkeit der Richter
1016Guidelines on the Role of ProsecutorsLeitlinien betreffend die Rolle der Staatsanwälte
1017scoringBruchrillen
1018rifling impressionSchussspuren
1019JCOGZA
1020profilerFallanalytiker
1021CPICPI
1022victim support organisationOpferschutzorganisation
1023MRTDmaschinell lesbares Reisedokument
1024Permanent Secretariat for Prevention PolicyStändiges Sekretariat für Präventionspolitik
1025principle of “originator control”Grundsatz der Kontrolle durch den Urheber
1026second phase of the programme of incentives and exchanges, training and cooperation for legal practitioners (Grotius II – Criminal)zweite Phase des Programms für die Förderung, den Austausch, die Aus- und Fortbildung sowie die Zusammenarbeit von Angehörigen der Rechtsberufe (Grotius II – Strafrecht)
1027runnerKurier
1028illicit enrichmentillegale Bereicherung
1029EuVidEuFID
1030security and society contractSicherheits- und Gesellschaftsvertrag
1031prevention contractPräventionsvertrag
1032coastal planKüstenaktionsplan
1033drug plan agreementDrogenplanvertrag
1034displacementUmsiedlungen und Verlagerungen von Anbauflächen
1035Joint Financial Investigation Clearing HouseGCF
1036alleged offendermutmasslicher Straftäter
1037Al-QaidaAl-Qaida
1038organised fraudBetrugsdelikt im Rahmen einer kriminellen Vereinigung
1039Pericles programmeAktionsprogramm in den Bereichen Austausch, Unterstützung und Ausbildung zum Schutz des Euro gegen Geldfälschung
1040key epidemiological indicatorwichtigste epidemiologische Indikatoren
1041profiling filterFahndungsraster
1042crime of aggressionVerbrechen der Aggression
1043acquisitive offenceVermögenskriminalität
1044terrorist offenceterroristische Straftat
1045comprehensive convention on international terrorismUmfassendes Übereinkommen über den internationalen Terrorismus
1046Coordination and Cooperation Mechanism on Drugs between the European Union, Latin America and the CaribbeanEU-LAK-Mechanismus zur Koordinierung und Zusammenarbeit im Bereich der Drogenbekämpfung
1047Ad hoc Committee on the Negotiation of a Convention against CorruptionAd-hoc-Ausschuss für die Aushandlung eines Übereinkommens gegen die Korruption
1048scale of sentencesAbstufung der Strafen
1049forensic accountancyforensische Rechnungsprüfung
1050drug GSPAPS-Drogensonderregelung
1051CISZollinformationssystem
1052criminal conductstrafbares Verhalten
1053deportation or forcible transfer of populationVertreibung oder zwangsweise Überführung der Bevölkerung
1054car-jackingCarjacking
1055ecoterrorismÖkoterrorismus
1056Europol’s computerised tool for secure exchange of information and intelligenceEuropols computergestütztes Instrument für den sicheren Austausch von Informationen und Intelligence
1057OASISOASIS
1058intentional conductvorsätzliche Handlung
1059SECI CenterSECI-Zentrum
1060cluster analysisClusteranalyse
1061home-jackingHome-jacking
1062highway-jackingHighway-jacking
1063improper matched orderImproper Matched Order
1064family group conferencingGesprächssitzungen mit Tätern und Betroffenen
1065national desknationales Verbindungsbüro
1066alternative remittancealternative Überweisung
1067CTTFTask Force “Terrorismusbekämpfung”
1068nuclear terrorismA-Terror
1069universal jurisdictionuniverselle Gerichtsbarkeit
1070indigenous terrorist groupnationale/regionale Terrorgruppe
1071AGISAGIS
1072nuclear forensicsnukleare Forensik
1073bait moneyVorzeigegeld
1074NIRSNah-Infrarot-Spektrometrie
1075issuing Member StateAusstellungsmitgliedstaat
1076assisting unlawful immigrationBeihilfe zur unerlaubten Ein- und Durchreise und zum unerlaubten Aufenthalt
1077EDEWGEDEWG
1078agro-terrorismAgrar-Terrorismus
1079volume crimeMassenkriminalität
1080vehicle/property crimeKSD
1081CIRAMCIRAM
1082NSCOCNationaler Dienst zur Bekämpfung der organisierten Kriminalität
1083Model Agreement for setting up a Joint Investigation Team (JIT)Modell für eine Vereinbarung über die Bildung einer gemeinsamen Ermittlungsgruppe
1084CADAPCADAP-Programm
1085Additional Protocol to the Convention on Cybercrime, concerning the criminalisation of acts of a racist and xenophobic nature committed through computer systemsZusatzprotokoll zum Übereinkommen über Computerkriminalität betreffend die Kriminalisierung mittels Computersystemen begangener Handlungen rassistischer und fremdenfeindlicher Art
1086public health problemProblem von gesundheitspolitischer Bedeutung
1087criminal proceedingsStrafprozess
1088cathineCathin
1089Protocol amending the European Convention for the Suppression of TerrorismProtokoll zur Änderung des Europäischen Übereinkommens zur Bekämpfung des Terrorismus
1090EEWEuropäische Beweisanordnung
1091Financial Action Task Force of South America Against Money LaunderingSüdamerikanische Arbeitsgruppe “Bekämpfung der Geldwäsche”
1092Protocol drawn up on the basis of Article 43(1) of the Convention on the Establishment of a European Police Office (Europol Convention), amending that ConventionProtokoll aufgrund von Artikel 43 Absatz 1 des Übereinkommens über die Errichtung eines Europäischen Polizeiamts (Europol-Übereinkommen) zur Änderung dieses Übereinkommens
1093APIAPI-Daten
1094crude nuclear bombprimitive Kernsprengkörper
1095RDDRDD
1096solidarity commitmentSolidaritätsverpflichtung
1097terrorist groupterroristische Vereinigung
1098structured associationorganisierter Zusammenschluss
1099DU weaponDU-Waffe
1100freezing orderSicherstellungsentscheidung
1101recruitment for terrorismRekrutierung für den Terrorismus
1102PMOIPMOI
1103NLANLA
1104trafficking in works of artillegaler Handel mit Kunstgegenständen
1105constituent element of a criminal actStraftatbestand
1106C.C.StGB
1107Code of criminal procedureStPO
1108embezzlementUnterschlagung
1109prison lawStrafvollzugsrecht
1110substantive criminal lawStraf-Sachrecht
1111collusive biddingAngebotsabsprache
1112passive briberyBestechlichkeit
1113active briberyBestechung
1114Convention on mutual assistance in criminal mattersÜbereinkommen über die Rechtshilfe in Strafsachen
1115sexual assaultsexuelle Gewalt
1116breach of trustMissbrauch des Vertrauens
1117accusedAngeklagter
1118criminal caseStrafsache
1119B & EEinbruch
1120code of criminal procedureStrafprozessordnung
1121complicityBeihilfe
1122connivanceheimliches Einverständnis
1123gaolGefängnis
1124incitementAnstiftung zu einem Verbrechen
1125prison for convicts sentenced to solitary confinement and hard labourZuchthaus
1126fraudulent representationFalschdarstellung
1127fraud in mortgage dealingsBetrug
1128armed robberyRaubüberfall
1129housebreakingDiebstahl durch Einsteigen
1130pecuniary penaltyGeldstrafe
1131forensic matters and criminal records departmentsKriminaltechnik und Erkennungsdienst
1132inside dealingInsider-Geschäfte
1133CATFAktionsgruppe für chemische Erzeugnisse
1134DWIAlkohol am Steuer
1135customs offenceZollzuwiderhandlung
1136fingerprintFingerabdruck
1137criminal justiceStrafgerichtsbarkeit
1138cannabis resinCannabisharz
1139manicuremaniküren
1140firearmFeuerwaffe
1141Criminal CodeStrafgesetzbuch
1142conflict of interestInteressenkonflikt
1143DoS attackDenial of Service-Angriff
1144fraud preventionSchutzmaßnahmen gegen Betrug
1145slush fundschwarze Kasse
1146drug peddlerKleindealer
1147black marketillegaler Umschlagplatz
1148financial market manipulationMarktmanipulation
1149counterfeitingNachahmung
1150criminal proceedsillegal erworbene Vermögenswerte
1151AFISAFIS
1152personal fundsEigengeld
1153Act establishing the Code of Criminal ProcedureGesetz über die Einführung der Strafprozessordnung
1154Council for Legal Aid in Criminal Cases before the Supreme Court of the NetherlandsRat für Rechtshilfe in Strafsachen beim Hohen Rat der Niederlande
1155squattingBesetzung leerstehender Haeuser
1156discharge grantÜberbrückungsgeld
1157Procurator GeneralGeneralstaatsanwalt
1158freezingBeschlagnahme
1159long-term inmateGefangene mit Langstrafe
1160black moneySchwarzgeld
1161Military PrisonMilitärstrafvollzugsanstalt
1162gibbetGalgen
1163Attorney GeneralErster Staatsanwalt
1164kidnappingEntführung
1165monitored deliveryüberwachte Lieferung
1166violence at workGewalt am Arbeitsplatz
1167PavulonPancuroniumbromid
1168KinefilmKinefilm
1169comfort womenTrostfrauen
1170Committee on the implementation of the framework programme for police and judicial cooperation in criminal mattersAusschuss für die Durchführung des Rahmenprogramms betreffend die polizeiliche und justizielle Zusammenarbeit in Strafsachen
1171methaqualoneMethaqualon
1172nembutalPentobarbital
1173victimizationViktimisierung
1174public prosecutor before a court martialWehrdisziplinaranwalt
1175body packerBodypacker
1176negotiated pleaProzessabsprache
1177OAFCNOLAF-Netz von Kommunikationsbeauftragten im Bereich der Betrugsbekämpfung
1178E-POCEPOC
1179IDOBeamter für die Auswertung von Erkenntnissen
1180LENEuropäisches Strafverfolgungsnetz
1181vehicle-related crimeKfz-Kriminalität
1182CARINCARIN
1183European criminal recordEuropäisches Register der Verurteilungen und Rechtsverluste
1184European enforcement orderEuropäische Vollstreckungsanordnung
1185Ad hoc Committee on action against trafficking in human beingsAd-hoc-Ausschuss für Massnahmen zur Bekämpfung des Menschenhandels
1186European Forum for Restorative JusticeEuropäisches Forum für opferorientierte Justiz
1187Green paper on the approximation, mutual recognition and enforcement of criminal sanctions in the European UnionGrünbuch über die gegenseitige Anerkennung gerichtlicher Entscheidungen
1188OCTABewertung der Bedrohungslage im Bereich der organisierten Kriminalität
1189CICCCICC
1190DNA analysis fileDAD
1191untraceablesoffene Spuren
1192HRVGewalt im Namen der Ehre
1193AROVermögensabschöpfungsstelle
1194IP infringementVerletzung von Rechten des geistigen Eigentums
1195National Crime SquadNationale Ermittlungsteam der Niederlande
1196CT StrategyEU-Strategie zur Terrorismusbekämpfung
1197EU Strategy for Combating Radicalisation and Recruitment to TerrorismStrategie der Europäischen Union zur Bekämpfung von Radikalisierung und Anwerbung für den Terrorismus
1198CARICCRegionales Informations- und Koordinierungszentrum für Zentralasien
1199disruptionRepression
1200EAGEAG
1201MENAFATFFinancial Action Task Force – Nahost- und Nordafrika
1202Alliance Against Trafficking in PersonsAllianz gegen den Menschenhandel
1203EACNeuropäisches Netz zur Korruptionsbekämpfung
1204AML/CFTAML/CFT
1205Manual of ProcedureVerfahrenshandbuch
1206Inter-American Convention on Mutual Assistance in Criminal MattersInteramerikanisches Übereinkommen über die Rechtshilfe in Strafsachen
1207disruptive investigationspräventive Ermittlungen
1208Provision of information to Parliament in the fields of police and judicial cooperation incriminal mattersUnterrichtung des Parlaments in den Bereichen der polizeilichen und justiziellen Zusammenarbeit in Strafsachen
1209Consultation of Parliament in the fields of police and judicial cooperation in criminalmattersKonsultation des Parlaments in den Bereichen der polizeilichen und justiziellen Zusammenarbeit in Strafsachen
1210Recommendations in the fields of police and judicial cooperation in criminal mattersEmpfehlungen in den Bereichen der polizeilichen und justiziellen Zusammenarbeit in Strafsachen
1211reference dataFundstellendatensatz
1212Agreement between the International Criminal Court and the European Union on cooperation and assistanceAbkommen zwischen dem Internationalen Strafgerichtsfhof und der Europäischen Union über Zusammenarbeit und Unterstützung
1213Green Paper from the Commission – Procedural Safeguards for Suspects and Defendants in Criminal Proceedings throughout the European UnionGrünbuch der Kommission – Verfahrensgarantien in Strafverfahren innerhalb der Europäischen Union
1214combating crimeVerbrechensbekämpfung
1215cold hitZufallstreffer
1216international criminal lawinternationales Strafrecht
1217accumulated sentencekumulierte Strafe
1218consecutive sentenceGesamtstrafe
1219Brdo ProcessBRDO-Prozess
1220Convention on Laundering, Search, Seizure and Confiscation of the Proceeds from Crime and on the Financing of TerrorismKonvention des Europarates über Geldwäsche, Terrorismusfinanzierung sowie Ermittlung, Beschlagnahme und Einziehung von Erträgen aus Straftaten
1221Group of experts on the policy needs for data on crime and criminal justiceExpertengruppe zur Ermittlung des Bedarfs der Politik an Kriminalitäts- und Strafverfolgungsdaten
1222double barreled shotgunDoppelflinte
1223action leverVerschlusshebel
1224aimvisieren
1225aimVisierung
1226aiming pointZielmarke
1227aimingZielen
1228air dragLuftwiderstand
1229air pistolLuftdruckpistole
1230air rifleLuftgewehr
1231ammunitionMunition
1232ammunition codeMunitionskennzeichnung
1233angle of departureAbgangswinkel
1234angle of attackAnstellwinkel
1235angle of twistDrallwinkel
1236antimonyAntimon
1237anvilAmboss
1238aperture sightDiopter
1239apertureLochblende
1240armWaffe
1241army rifleArmeegewehr
1242assault rifleSturmgewehr
1243automatic fireSerienfeuer
1244autoloading rifleSelbstladegewehr
1245autoloading shotgunSelbstladeflinte
1246axle of cylinderTrommelachse
1247ball and shotgunBüchsflinte
1248ball powderKugelpulver
1249ballistic examinationballistische Untersuchung
1250ballisticianBallistiker
1251ballisticsBallistik
1252axis of the boreLaufachse
1253barrel lengthLauflänge
1254belted caseGürtelhülse
1255big game huntingHochwildjagd
1256birdshotSchrot
1257black powderSchwarzpulver
1258blank cartridgePlatzpatrone
1259blowback systemMasseverschluss
1260boat-tailHeckkonus
1261boltVerschluss
1262bolt headVerschlusskopf
1263boreLaufbohrung
1264bore gaugeKaliberlehre
1265breechVerschluss
1266breech blockVerschlussblock
1267bulletGeschoss
1268bullet weightGeschossgewicht
1269burst fireSerienfeuer
1270buttKolben
1271caliberKaliber
1272carbineKarabiner
1273cartridge chamberPatronenlager
1274combustionVerbrennung
1275curved trajectorygekrümmte Bahn
1276deflagrationDeflagration
1277detonationDetonation
1278double barrelled rifleDoppelbüchse
1279ejectausstoßen
1280entrance holeEinschussloch
1281exit holeAusschussloch
1282exit velocityAustrittsgeschwindigkeit
1283extraction forceAusziehkraft
1284extraction pressureAusziehdruck
1285extractorAuszieher
1286fire directionSchussrichtung
1287foresightKorn
1288fragmentSplitter
1289groove depthZugtiefe
1290handgunFaustfeuerwaffe
1291hardnessHärte
1292hitEinschlag
1293ignitionZündung
1294initial velocityAnfangsgeschwindigkeit
1295land diameterFelddurchmesser
1296leadBlei
1297leverHebel
1298light machine gunSchnellfeuergewehr
1299line of sightVisierlinie
1300muzzleMündung
1301octogonalachtkantig
1302pistolPistole
1303pistol gripPistolengriff
1304narcodollarDrogendollar
1305extraordinary renditionaußerordentliche Überstellung
1306International Convention Against Doping in SportInternationales Übereinkommen gegen Doping im Sport
1307statistical reasoningstatistische Argumentation
1308significance levelSignifikanzniveau
1309significanceBedeutung
1310scientific relevancewisschenschaftliche Relevanz
1311reproducible resultreproduzierbares Resultat
1312representativerepräsentativ
1313relevant populationrelevante Population
1314refutabilityWiederlegbarkeit
1315refutewiderlegen
1316reasonableangemessen
1317real valueRealwert
1318rangeSchwankungsbreite
1319random sampleZufallsstichprobe
1320fractileFraktil
1321prosecutor’s fallacyFehlschluss des Staatsanwaltes
1322evidential valueBeweiskraft
1323probabilityWahrscheinlichkeit
1324probabilistic viewWahrscheinlichkeitssicht
1325a priori probabilityA-priori-Wahrscheinlichkeit
1326predictvorhersagen
1327a posteriori probabilitya posteriori Wahrscheinlichkeit
1328positive matchpositive Übereinstimmung
1329peakGipfel
1330pooled standard deviationgepoolte Standardabweichung
1331oddeinzeln
1332objective criteriaobjektive Kriterien
1333numerical exampleZahlenbeispiel
1334modelModell
1335numerical datanumerische Daten
1336misinterpretationFehleinschätzung
1337matched samplesabgestimmte Vergleichsstichproben
1338match pointMatch-Punkt
1339matchÜbereinstimmung
1340masses of numerical dataMassen von numerischen Daten
1341likelihood ratio (LR)Likelihood-Quotient
1342least squares methodMethode der kleinsten Abstandsquadrate
1343interpret resultsErgebnisse auswerten
1344improbableunwahrscheinlich
1345groupingGruppierung
1346frameworkRahmenprogramm
1347falsifiablefalsifizierbar
1348fallaciousirrig
1349falsifiabilityFalsifizierbarkeit
1350external standardexterner Standard
1351expert at trialSachverständige
1352exhaustiveerschöpfend
1353experimentationExperiment
1354evidential valueBeweiskraft
1355evidence valueBeweiswerte
1356evenGerade
1357eventEreignis
1358estimatorSchätzer
1359estimated probabilitygeschätzte Wahrscheinlichkeit
1360error rangeFehlerbreite
1361discriminating powerDiskriminierungspotential
1362discriminating descriptorDiskriminierungsdeskriptor
1363dichotomic viewbinäres Sicht
1364densityDichte
1365criterionKriterium
1366defense strategyVerteidigungsstrategie
1367covarianceKovarianz
1368correspondenceKorrespondenz
1369correlation indexKorrelationsindex
1370consensus valueKonsensuswert
1371conditional probabilitybedingte Wahrscheinlichkeit
1372concordant samplekonkordante Stichprobe
1373combineKombinieren
1374concordant evidenceübereinstimmende Evidenz
1375biasBias
1376basic principlesGrundsätzen
1377assessment of the oddWahrscheinlichkeitsauswertung
1378assessabschätzen
1379analytical batchanalytisches Los
1380admissibilityZulässigkeit
1381agreementÜbereinstimmung
1382reference populationReferenzpopulation
1383correlationKorrelation
1384statistical researchstatistische Forschung
1385statisticsStatistik
1386testabilityTestbarkeit
1387two competitive hypotheseszwei wettbewerbsfähige Hypothesen
1388type I errorFehler 1.Art
1389uncertaintyUnsicherheit
1390uncertainty of the analysisUngewißheit der Analyse
1391validationValidierung
1392validityGültigkeit
1393variabilityVariabilität
1394weight of the evidenceBedeutung des Beweismateriales
1395intermediary payment service providerzwischengeschalteter Zahlungsverkehrsdienstleister
1396public condoningöffentliche Verteidigung
1397Research and Validation CommitteeForschungs- und Validierungsausschuss
1398AQIMAQM
1399ESOEuropäische Überwachungsanordnung
1400manual for cross-border inquiries in tracing supply channelsHandbuch für grenzüberschreitende Anfragen zur Rückverfolgung von Verkaufswegen
1401EPACEPAC
1402botnetBot-Netz
1403zero toleranceNull-Toleranz
1404probation measureBewährungsmaßnahme
1405unidentified DNA profileoffene Spur
1406reference DNA profileDNA-Personenprofil
1407ACTAACTA
1408COMMITAbgestimmte Mekong-Ministerinitiative gegen Menschenhandel
1409ACCORDKooperative Operationen des ASEAN und Chinas als Reaktion auf gefährliche Drogen
1410Community action programme to promote activities in the field of the protection of the Community’s financial interestsAktionsprogramm der Gemeinschaft zur Förderung von Maßnahmen auf dem Gebiet des Schutzes der finanziellen Interessen der Gemeinschaft
1411Community action programme to promote activities in the field of the protection of the financial interests of the CommunityAktionsprogramm der Gemeinschaft zur Förderung von Maßnahmen auf dem Gebiet des Schutzes der finanziellen Interessen der Gemeinschaft
1412most serious crimes principleGrundsatz, wonach die Todesstrafe nur für schwerste Verbrechen verhängt werden darf
1413Directive on the protection of the environment through criminal lawRichtlinie über den strafrechtlichen Schutz der Umwelt
1414Basic principles on the use of restorative justice programmes in criminal mattersGrundprinzipien für den Einsatz der ausgleichsorientierten Justiz in Strafsachen
1415concurrent offencesKonkurrenzen
1416temporary surrendervorübergehende Übergabe
1417full matchvollständige Übereinstimmung
1418ROCTABewertung der Bedrohungslage im Bereich der russischen organisierten Kriminalität
1419MAOC (N)MAOC-N
1420ECRISECRIS
1421Specific Programme ‘Criminal Justice’spezifisches Programm “Strafjustiz”
1422EU child alert systemeuropaweites Alarmsystem für vermisste Kinder
1423online searchOnline-Durchsuchung
1424vulnerable victimgefährdetes Opfer
1425Article 98 agreementNichtüberstellungsabkommen
1426strict criminal liabilityobjektive strafrechtliche Verantwortlichkeit
1427CodeWADA-Kodex
1428cyberbullyingCyber-Mobbing
1429Treaty between the Kingdom of the Netherlands and the Federal Republic of Germany concerning cross-border police cooperation in criminal mattersVertrag zwischen dem Königreich der Niederlande und der Bundesrepublik Deutschland über die grenzüberschreitende polizeiliche Zusammenarbeit und die Zusammenarbeit in strafrechtlichen Angelegenheiten
1430revised strategy on terrorist financingüberarbeitete Strategie gegen die Terrorismusfinanzierung
1431vishingVishing
1432identity fraudIdentitätsbetrug
1433Section of Forensic GeneticsAbteilung Rechtsgenetik
1434person remanded in custodyUntersuchungshäftling
1435EUDPDEU-Datenbank zu Drogen-Profilanalysen
1436EDPSEDPS
1437Green Paper on obtaining evidence in criminal matters from one Member State to another andsecuring its admissibilityGrünbuch “Erlangung verwertbarer Beweise in Strafsachen aus einem anderen Mitgliedstaat”
1438EPRISEPRIS
1439surveillanceÜberwachen
1440personal securityPersonenschutz
1441preventionPrävention
1442ATCEU-Koordinator für die Bekämpfung des Menschenhandels
1443Council Decision 2008/616/JHA on the implementation of Decision 2008/615/JHA on the stepping up of cross-border cooperation, particularly in combating terrorism and cross-border crimeBeschluss 2008/616/JI des Rates vom 23. Juni 2008 zur Durchführung des Beschlusses 2008/615/JI zur Vertiefung der grenzüberschreitenden Zusammenarbeit, insbesondere zur Bekämpfung des Terrorismus und der grenzüberschreitenden Kriminalität,
1444Manual on cross-border operationsHandbuch für grenzüberschreitende Einsätze
1445MMFMassen-Marketingbetrug
1446counterfeiting of means of paymentFälschung von Zahlungsmitteln
1447Euro-crimeStraftat mit europäischer Dimension
1448maritime piracyPiraterie auf See
1449terrorist financingTerrorismusfinanzierung
1450IBINIBIN
1451fuel launderingHeizölverdieselung
1452laundered fuelverdieseltes Heizöl
1453IFRTIFRT
1454EIOEEA
1455EurofiscEurofisc
1456ENFASTENFAST
1457IMSBerichterstattungssystem für Unregelmäßigkeiten
1458illicit tobacco trafficunerlaubter Handel mit Tabakerzeugnissen
1459NCB confiscationEinziehung ohne vorhergehende Verurteilung
1460Eurojustice network of European Prosecutors-GeneralEurojustice-Netz europäischer Generalanwälte
14613rd AML/CTF Directive3. Geldwäscherichtlinie
1462Cash Control RegulationVerordnung (EG) Nr. 1889/2005 des Europäischen Parlaments und des Rates vom 26. Oktober 2005 über die Überwachung von Barmitteln, die in die Gemeinschaft oder aus der Gemeinschaft verbracht werden
1463EC3Europäisches Zentrum zur Bekämpfung der Cyberkriminalität
1464NASNarcotic Affairs Section in der US-Botschaft
1465SIENANetzanwendung für sicheren Datenaustausch
1466secondary extractionSekundärextraktion
1467repeat victimisationerneut zum Opfer werden
1468pharmaceutical crimeArzneimittelkriminalität
1469EU TFTSSystem zum Aufspüren der Terrorismusfinanzierung
1470narco-stateDrogenstaat
1471European Action Pact for Compensation for Trafficked PersonsCOMP.ACT
1472sexual exploitationsexuelle Ausbeutung
1473Strengthening mutual trust in the European judicial area – A Green Paper on the application of EU criminal justice legislation in the field of detentionStärkung des gegenseitigen Vertrauens im europäischen Rechtsraum – Grünbuch zur Anwendung der EU-Strafrechtsvorschriften im Bereich des Freiheitsentzugs
1474child abductionEntziehung Minderjähriger
1475wrongful retention of a childVorenthalten eines Kindes
1476wrongful removal of a childwiderrechtliches Verbringen eines Kindes
1477international child abductioninternationale Kindesentführung
1478incestBeischlaf zwischen Verwandten
1479domestic violenceGewalt in der Familie
1480marital violenceGewalt in der Partnerschaft
1481familial sex offencessexuelle Gewalt innerhalb der Familie
1482genital mutilationGenitalverstümmelung
1483gender-based violencegeschlechtsbezogene Gewalt
1484marital rapeVergewaltigung in der Ehe
1485physical violencekörperliche Misshandlung
1486rapeNotzucht
1487fondlingsexuell bestimmte körperliche Berührung
1488excisionExzision
1489infibulationInfibulation
1490emasculationEmaskulation
1491female genital mutilationGenitalverstümmelung bei Frauen
1492male genital mutilationmännliche Genitalverstümmelung
1493violent extremismgewalttätiger Extremismus
1494MUJAOBewegung für Einheit und Dschihad in Westafrika
1495conviction-based confiscationEinziehung aufgrund einer Verurteilung
1496extended confiscationerweiterte Einziehung
1497confiscation from a third partyDritteinziehung
1498asset recoveryAbschöpfung illegalen Vermögens
1499financial investigationFinanzermittlung
1500SOCTABewertung der Bedrohungslage im Bereich der schweren und organisierten Kriminalität
1501Third Additional Protocol to the European Convention on ExtraditionDrittes Zusatzprotokoll zum Europäischen Auslieferungsübereinkommen
1502act of aggressionAggression
1503exterminationAusrottung
1504apartheidApartheid
1505human traffickerMenschenhändler
1506transplant commercialismKommerzialisierung von Transplantationen
1507transplant tourismTransplantationstourismus
1508Cape Town PrinciplesPrinzipien von Kapstadt
1509jus ad bellumRecht zum Krieg
1510jus in belloRecht im Krieg
1511Nuremberg PrinciplesNürnberger Prinzipien
1512principle of distinctionPrinzip der Unterscheidung
1513intimidation of witnessEinschüchterung von Zeugen
1514asset misappropriationVermögensschädigung
1515human smugglingEinschleusen von Ausländern
1516AITFAITF
1517abuse of functionsAmtsmissbrauch
1518internal traffickinginländischer Menschenhandel
1519slave tradeSklavenhandel
1520organised immigration crimeorganisierte Schleuserkriminalität
1521forced commercial sexual exploitationsexuelle Ausbeutung zu kommerziellen Zwecken
1522organised sex tourismorganisierter Sextourismus
1523EPEEPE
1524EU drugs strategy (2013-2020)EU-Drogenstrategie (2013-2020)
1525Pericles 2020Aktionsprogramm in den Bereichen Austausch, Unterstützung und Ausbildung zum Schutz des Euro gegen Geldfälschung
1526EIXMEIXM
1527embezzlement of public fundsmissbräuchliche Verwendung
1528briberyBestechung
1529facilitation paymentSchmiergeldzahlung
1530graftSchiebung
1531pecuniary chargefinanzielle Belastung
1532self-dealingInsichgeschäft
1533misappropriationUntreue
1534fiscal fraudSteuer- und Leistungsbetrug
1535benefit fraudLeistungsmissbrauch
1536judicial approvalrichterliche Genehmigung
1537EurojustAgentur der Europäischen Union für justizielle Zusammenarbeit in Strafsachen
1538biodata integrationIntegration der Personaldaten
1539photo integrationIntegration des Lichtbildes
1540signature integrationIntegration der Unterschrift
1541machine verifiable featuremaschinell prüfbares Merkmal
1542fluorescent security threadfluoreszierender Sicherheitsfaden
1543fluorescent stitching threadfluoreszierender Heftfaden
1544Identigram®Identigram®
1545iridescent laminateirisierendes Folienelement
1546laminate integrated by bindingFolie in die Bindung integriert
1547laminate UV featureUV-Merkmal der Folie
1548EU policy cycle for organised and serious international crimeEU-Politikzyklus
1549Hercule IIIProgramm “Hercule III”
1550Data Protection Law Enforcement DirectiveRichtlinie (EU) 2016/680 des Europäischen Parlaments und des Rates vom 27. April 2016 zum Schutz natürlicher Personen bei der Verarbeitung personenbezogener Daten durch die zuständigen Behörden zum Zwecke der Verhütung, Ermittlung, Aufdeckung oder Verfolgung von Straftaten oder der Strafvollstreckung sowie zum freien Datenverkehr und zur Aufhebung des Rahmenbeschlusses 2008/977/JI des Rates
1551INTERPOL Illicit Arms Records and tracing Management SystemINTERPOL-Datenbank zur Aufspürung und Rückverfolgung illegaler Waffen
1552International Standards on Combating Money Laundering and the Financing of Terrorism & Proliferationinternationale Standards zur Bekämpfung von Geldwäsche, Terrorismus- und Proliferationsfinanzierung
1553tactical houseÜbungshaus
1554delinquent behaviourJugendkriminalität
1555EU Action Plan on Drugs 2013-2016Drogenaktionsplan der EU (2013-2016)
1556money muleGeldkurier
1557clandestine drug laboratoryillegales Drogenlabor
1558drug-trafficking criminal organisationDrogenhandelsorganisation
1559drug interdictionDrogenabwehr
1560AIRCOPAIRCOP
1561Protocol to eliminate illicit trade in tobacco productsProtokoll zur Unterbindung des unerlaubten Handels mit Tabakerzeugnissen
1562bureaucratic corruptionKleinkorruption
1563grand corruptionGroßkorruption
1564bribery of a foreign public officialAuslandsbestechung
1565off-line grooming„off-line“ begangene Kontaktaufnahme
1566pre-inchoate offenceVorbereitungshandlung zu einem sexuellen Missbrauch
1567vote-buyingStimmenkauf
1568false accountingBilanzfälschung
1569self-launderingSelf-Cleaning
1570negligent financing of briberyfahrlässige Finanzierung von Bestechung
1571relevant wrongdoingFehlverhalten
1572misconduct in officeFehlverhalten in einem öffentlichen Amt
1573organised crime leaderAnführer von Gruppen der organisierten Kriminalität
1574diversion of public fundsVeruntreuung öffentlicher Gelder
1575forged documentVerfälschung
1576incriminationInkulpation
1577Hofstad NetworkHofstadgroep
1578Holy Land Foundation for Relief and DevelopmentStiftung für Hilfe und Entwicklung im Heiligen Land
1579Islamic Jihad of YemenIslamischer Dschihad im Jemen
1580asset forfeitureEinziehung von Vermögenswerten
1581internet crimeInternet-Kriminalität
1582corrective rapeKorrekturvergewaltigung
1583food crimeLebensmittelkriminalität
1584Glossary of Firearms TerminologyGlossar der Feuerwaffenbezeichnungen
1585EFEArbeitsgruppe der europäischen Waffenexperten
1586QaedistAl-Qaida-Anhänger
1587Joint Research Centre on Transnational CrimeGemeinsames Forschungszentrum für transnationale Kriminalität
1588organised property crimeorganisierte Eigentumskriminalität
1589EuroPrisEuroPris
1590EU IRUEU IRU
1591car hackingAuto-Hacking
1592ECTCECTC
1593EU-internal terroristEU-interner Terrorist
1594SoIPerson, gegen die ermittelt wird
1595PCFZahlungskartenbetrug
1596FP TravellersKontaktstelle TRAVELLERS
1597nationality swappingVerschleierung der tatsächlichen Staatsangehörigkeit
1598CARPOLCARPOL
1599AQISAQIS
1600impersonation of a public employeeAmtsanmaßung
1601COD-CTEAusschuss “Ausländische terroristische Kämpfer und damit verbundene Fragen”
1602FP FirearmsKontaktstelle Feuerwaffen
1603Act on prosecuting the preparation of serious acts of violent subversionGVVG
1604EMSCEuropäisches Zentrum zur Bekämpfung der Migrantenschleusung
1605EMISTEMIST
1606CEPOLAgentur der Europäischen Union für die Aus- und Fortbildung auf dem Gebiet der Strafverfolgung
1607ping orderPing-Auftrag
1608concealing ownershipConcealing Ownership
1609hype and dumpPumping and dumping
1610FOG documentin betrügerischer Weise erlangtes Dokument
1611wildlife traffickingillegaler Artenhandel
1612index-filterIndexfilter
1613loss of locationStandortverlust
1614document expertDokumentenexperte
1615European Union Agency for law enforcement cooperationAgentur der Europäischen Union für die Zusammenarbeit auf dem Gebiet der Strafverfolgung
1616CJPECriminal Justice Platform Europe
1617ALDODokumentensachverständiger
1618assisting European Delegated Prosecutorunterstützender Europäischer Delegierter Staatsanwalt
1619supervising European Prosecutordie Aufsicht führender Europäischer Staatsanwalt
1620FP HydraKontaktstelle Hydra
1621cellular confinementEinzearrest

SIGN IN

Forgot Password

X